KEGG   Alcanivorax dieselolei: B5T_02209Help
Entry
B5T_02209         CDS       T02259                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
adi  Alcanivorax dieselolei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:adi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B5T_02209 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B5T_02209 (cheB)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B5T_02209 (cheB)
Two-component system [BR:adi02022]
 CheA family
  CheA-CheYBV
   B5T_02209 (cheB)
Bacterial motility proteins [BR:adi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B5T_02209 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427945..2428520
Genome map
AA seq 191 aa AA seqDB search
MRRAVKAVVMGASWGGLNAFSTILAGLPARFPAAVLLVQHQHASADNRLAWLLSRYSTLP
VRAPEDKEEILPGHVYVAPPGYHMLVNEDDTVALSTYRPVHFSRPSIDELFFSAGHAYGA
ALVGVLLTGANDDGSDGLDYIRRRGGHTLVQSPQSSEAPVMPEAAIIKGAAREVLDLERI
GPYLADYLVGL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggcggtgaaagcggtggtaatgggggcgtcctgggggggattgaacgccttc
tccacgattctggccggtttgccggcgcggtttccggccgccgtgctgctggtccagcat
caacacgccagcgccgacaaccggctggcgtggttgttgtcccgctacagcaccttgccg
gtacgggctccggaggataaggaagagattctgcctggtcacgtttatgtggcgccgccg
gggtaccacatgctggtcaacgaggacgacaccgtggcactttccacctatcggccggtg
catttttcccggccgtccattgatgagctgttcttctccgcgggtcatgcctatggcgcg
gcgctggttggcgtattgttgactggcgccaacgacgacggctccgacggtctcgattat
atccgtcggcgcggcggccacactctggtgcagtcaccgcaaagcagcgaggcgccggtg
atgcccgaggcggcgataataaaaggcgcggcgcgggaggtgctcgatctggaacggatc
gggccgtacctggcggactatttggttgggctgtga

DBGET integrated database retrieval system