KEGG   Alcanivorax dieselolei: B5T_02209Help
Entry
B5T_02209         CDS       T02259                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
adi  Alcanivorax dieselolei
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:adi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:adi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427945..2428520
Genome map
AA seq 191 aa AA seqDB search
MRRAVKAVVMGASWGGLNAFSTILAGLPARFPAAVLLVQHQHASADNRLAWLLSRYSTLP
VRAPEDKEEILPGHVYVAPPGYHMLVNEDDTVALSTYRPVHFSRPSIDELFFSAGHAYGA
ALVGVLLTGANDDGSDGLDYIRRRGGHTLVQSPQSSEAPVMPEAAIIKGAAREVLDLERI
GPYLADYLVGL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggcggtgaaagcggtggtaatgggggcgtcctgggggggattgaacgccttc
tccacgattctggccggtttgccggcgcggtttccggccgccgtgctgctggtccagcat
caacacgccagcgccgacaaccggctggcgtggttgttgtcccgctacagcaccttgccg
gtacgggctccggaggataaggaagagattctgcctggtcacgtttatgtggcgccgccg
gggtaccacatgctggtcaacgaggacgacaccgtggcactttccacctatcggccggtg
catttttcccggccgtccattgatgagctgttcttctccgcgggtcatgcctatggcgcg
gcgctggttggcgtattgttgactggcgccaacgacgacggctccgacggtctcgattat
atccgtcggcgcggcggccacactctggtgcagtcaccgcaaagcagcgaggcgccggtg
atgcccgaggcggcgataataaaaggcgcggcgcgggaggtgctcgatctggaacggatc
gggccgtacctggcggactatttggttgggctgtga

DBGET integrated database retrieval system