KEGG   Alcanivorax dieselolei: B5T_02226Help
Entry
B5T_02226         CDS       T02259                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
adi  Alcanivorax dieselolei
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B5T_02226
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     B5T_02226
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     B5T_02226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2447274..2447819)
Genome map
AA seq 181 aa AA seqDB search
MSNLKIFHDGEPENPQLVVESKAAMAVELAKAGIRYEQWQATKPLTASPSQEEVLEAYAQ
DIDRLKREEGYQTVDVVSMQPDHPDKAVFREKFLDEHRHSEDEVRFFVEGQGLFTLHIEG
QVYEVLCTKGDLISVPANTAHWFDMGPNPHFVAIRLFNNPEGWVANFTGSDIAGRFSRLE
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaaaattttccacgacggtgaaccggagaatccgcaactggtggtggaa
agcaaagccgccatggcggtggaactggccaaggccgggatccgctatgaacaatggcag
gcgaccaagccgttgacggccagtccatcccaggaagaagtgctggaagcctacgcccag
gacatcgaccgcctgaagcgcgaggaaggctaccagaccgtggacgtggtcagcatgcaa
ccggatcatccggacaaagcggtgttccgggaaaagtttctggacgagcaccgccactcg
gaagacgaggttcgtttcttcgtcgagggtcagggactgtttacgttgcacatcgagggc
caggtttatgaagtgttgtgcaccaagggcgacctgatctcggtgccggctaataccgcg
cactggttcgatatgggcccgaacccgcacttcgtggccatccgtttgttcaataatccg
gaaggctgggtggccaacttcaccggcagtgatatcgccggccggttcagccgcctggag
aactga

DBGET integrated database retrieval system