KEGG   Alcanivorax dieselolei: B5T_02332Help
Entry
B5T_02332         CDS       T02259                                 

Gene name
tesA
Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
adi  Alcanivorax dieselolei
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    B5T_02332 (tesA)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B5T_02332 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     B5T_02332 (tesA)
Lipid biosynthesis proteins [BR:adi01004]
 Fatty acid synthase
  Component type
   B5T_02332 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2557588..2558187)
Genome map
AA seq 199 aa AA seqDB search
MVILLFLAPLLGRTQGIVVLGDSISAGYGLEETEGWVHLLGQRLASQCSAMPVINASVSG
ETSDGGVSRLPALLERHQPDVLVLELGGNDGLRGLPPSRLAGNLEKMVSFGQQAGARVVL
LGMRIPPNYGRVYTERFEAVFKQVAENNALPWVPFFLDGVVEAGQIQSDGIHPTAEAQPT
LLDNAWPILQDVLPKDCQQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggtcatactgttgttcctcgcgcctttactgggccgcacgcagggcattgtggtgctg
ggtgacagcatcagcgccggctacggtctggaagaaacggagggttgggtgcaccttctc
ggacaacggctggcaagtcaatgttccgcgatgccggtgatcaatgcgtcggtgagcggt
gaaaccagtgatggtggtgtcagccgcctgccggccttgttggaacgacaccagccggac
gttctggtgctggaactgggcggtaacgatggccttcgtggcctgccgccgagtcgtctg
gccggcaatctggaaaaaatggtgtccttcggccagcaggccggcgcccgggtggtgttg
ctcggaatgcgcattccgcccaattatggtcgtgtctacaccgaacgtttcgaggcggtg
ttcaagcaggtggcggagaacaacgcgttgccctgggtgccgtttttcctcgacggcgtg
gtggaagccggccagattcaaagcgacggcattcaccccaccgccgaggcccagcccacc
ctgctggataacgcctggccgattttgcaggacgtgttgccgaaggactgccagcaatga

DBGET integrated database retrieval system