KEGG   Alcanivorax dieselolei: B5T_02332Help
Entry
B5T_02332         CDS       T02259                                 

Gene name
tesA
Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
adi  Alcanivorax dieselolei
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:adi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2557588..2558187)
Genome map
AA seq 199 aa AA seqDB search
MVILLFLAPLLGRTQGIVVLGDSISAGYGLEETEGWVHLLGQRLASQCSAMPVINASVSG
ETSDGGVSRLPALLERHQPDVLVLELGGNDGLRGLPPSRLAGNLEKMVSFGQQAGARVVL
LGMRIPPNYGRVYTERFEAVFKQVAENNALPWVPFFLDGVVEAGQIQSDGIHPTAEAQPT
LLDNAWPILQDVLPKDCQQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggtcatactgttgttcctcgcgcctttactgggccgcacgcagggcattgtggtgctg
ggtgacagcatcagcgccggctacggtctggaagaaacggagggttgggtgcaccttctc
ggacaacggctggcaagtcaatgttccgcgatgccggtgatcaatgcgtcggtgagcggt
gaaaccagtgatggtggtgtcagccgcctgccggccttgttggaacgacaccagccggac
gttctggtgctggaactgggcggtaacgatggccttcgtggcctgccgccgagtcgtctg
gccggcaatctggaaaaaatggtgtccttcggccagcaggccggcgcccgggtggtgttg
ctcggaatgcgcattccgcccaattatggtcgtgtctacaccgaacgtttcgaggcggtg
ttcaagcaggtggcggagaacaacgcgttgccctgggtgccgtttttcctcgacggcgtg
gtggaagccggccagattcaaagcgacggcattcaccccaccgccgaggcccagcccacc
ctgctggataacgcctggccgattttgcaggacgtgttgccgaaggactgccagcaatga

DBGET integrated database retrieval system