KEGG   Alcanivorax dieselolei: B5T_02424Help
Entry
B5T_02424         CDS       T02259                                 

Definition
GMC oxidoreductase family
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
adi  Alcanivorax dieselolei
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2667364..2668935)
Genome map
AA seq 523 aa AA seqDB search
METVATLIIGSGFGGSVMACRLAERGEQVVVLERGRRWQSRDYPSVSQDNWLWDEDEPEH
QNGWLDFRYFGDMSIAMGAGVGGGSLIYANVSLDARPEMFEQGWPEAIRYPQLSRHYHTV
GQMMGVQSLPDNQWTPRTRLMHEAAEKLGHGGRFKVVPQAIQFDPDWHAGLDDAYDYRHS
KTWTNAHGREQGTCVHCGNCDLGCPVSAKNTLDLNYLARAEQHGADIRPLHHVRWIRPLE
DGRYEVGVRDLLAGTWRRYRANRVIVAAGSVGSTELLLRCRDQYRTLPKLSRALGRNWSC
NGDFFTPALYSDREIAPTRGPTITSAIDYLDGSDNGARYLVEDGGLPDLLGNLLEHTARH
PRLARTRLGAAMLEYGEDSNPFLRMMPWFGQAVDDPGGRFRLGRRWYAPWKKDRLRLKWD
YRKAEKAVQALADRHLALTEATGGRGMTPATWKWFKNLVTPHPLGGCGMADDPKQGVVDH
SGAVFHYPGLYVVDGAMVPRALGLNPSKTIAALAEYAATRMPD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtggcgacactgattatcggcagtgggttcggcgggtcggtgatggcctgc
cggctggcggaacgcggggaacaggtggtggtgctggagcggggacgccgctggcaatcg
cgggactaccccagcgtcagccaggacaactggttatgggatgaggacgagcccgagcat
cagaatggctggctcgacttccgctacttcggcgacatgagcatcgccatgggcgcgggc
gtgggcggcggttcgctgatctatgccaacgtcagcctggatgcccggccggagatgttc
gaacaggggtggccggaagccattcgctacccgcaattgagccgccattaccacaccgtc
ggtcaaatgatgggggtgcaatcgctgccggacaatcaatggacaccgcgtacccgcctg
atgcacgaagcggcggaaaagctcggccacggtggccgtttcaaagtggtgccgcaagcg
atccagttcgatccggactggcatgccggcctcgatgacgcctacgactatcgccacagt
aaaacctggaccaacgcccacggccgtgagcagggtacctgcgtgcattgcggcaattgc
gatctgggatgcccggtgagcgccaagaacaccctggatttgaactatctggcgcgggcc
gagcagcacggcgccgatatccgcccgttgcaccatgtgcgctggatacgcccgctggag
gatgggcgttacgaggtgggcgtgcgtgatctgctggccggtacctggcgccgctaccgc
gccaaccgggtgatcgtcgccgccggcagtgtcggttccaccgagttgctgctgcgttgc
cgcgatcagtaccgcaccttgccgaagctgagccgggcgttgggacgaaattggagttgc
aacggcgacttcttcacgccggcgctctattccgatcgcgagatcgcgccgacccgcggc
cccaccatcaccagcgccatcgattacctggacggcagcgacaatggcgcccgctacctg
gtggaggacggcggtttaccggacctgctgggtaacctgctggagcacaccgcccggcac
ccgcggctggcccgcacccgccttggcgcggcgatgctggaatatggcgaggacagtaac
ccgttcctgcgcatgatgccgtggttcggccaggccgtggacgaccccggcggccgtttc
cgcctgggccggcgctggtacgcgccctggaaaaaggaccggctgcggctgaaatgggat
taccgcaaggcggaaaaagcggtgcaggcgctggccgaccgccacctggcgttgaccgaa
gccaccggcgggcggggcatgacgccggccacctggaagtggttcaagaatctggtgacc
ccccatccgctgggtggctgcggtatggccgacgaccccaagcagggggtggtggatcac
agcggcgcggtattccactatcccggcctatacgtggtggacggtgccatggtgccccgt
gccctgggattgaacccgtccaagaccatcgccgccctggccgagtacgccgccacgcga
atgccggattaa

DBGET integrated database retrieval system