KEGG   Alcanivorax dieselolei: B5T_02632Help
Entry
B5T_02632         CDS       T02259                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00260  Glycine, serine and threonine metabolism
adi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01130  Biosynthesis of antibiotics
adi01230  Biosynthesis of amino acids
Module
adi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5T_02632 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B5T_02632 (trpA)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B5T_02632 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFT70902
UniProt: K0CGP6
Position
complement(2925251..2926054)
Genome map
AA seq 267 aa AA seqDB search
MSRIQACFEQLNTSGRKALIPYITAGDPNQAVTVPVMHAMVEAGADIIELGVPFSDPMAD
GPVIQKACERALEAGTSLRDVLAMVADFRRQDDRTPVVLMGYLNPVEAMGYQTFADACVS
AGVDGVLLVDLPPEECEDIAPQFRQRGVDLIFLVAPTTTDERIRRIGEAASGYLYYVSLK
GVTGAATLNVEEVASRVETIRNLAQLPIGVGFGIKDAASARAVSRVADGVVVGSALVNQI
AANAQRPEAIAPAVAAVLADMRSAMDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtattcaagcctgtttcgaacaactgaacacgagcggccgcaaggcgctgatt
ccctatatcaccgccggtgatcccaaccaggccgtgaccgtgccggtgatgcacgcgatg
gtggaggcgggagccgacatcatcgagctgggggtgccgttctccgaccccatggccgac
ggcccggtgatccagaaagcctgtgagcgggcactggaggccggcaccagcctgcgcgac
gtgctcgccatggtcgccgatttccgccgccaggacgatcgcactccggtggtactgatg
ggctatctgaacccggtggaagccatgggttaccagaccttcgccgatgcctgcgtcagc
gccggcgtggacggggtgctgctggtggacctgccgccggaggaatgcgaggacatcgcg
ccgcaatttcgccagcgcggtgtcgatctgatcttcctggtggcgccgaccaccaccgat
gagcgcatccgtcgcatcggcgaggcggccagcggttatctttactatgtctccctgaag
ggcgtcaccggcgccgccaccctcaatgtggaggaagtggcgtcgcgggttgaaacaatt
cgcaaccttgcccaattgcccattggggtaggctttggtatcaaagacgcggcatcggcc
cgggctgtcagccgggtcgccgatggcgtggtggtgggcagcgcgctggtcaaccagatc
gccgccaacgcgcaacgccccgaagccatcgcaccggcggtggcggccgtgcttgccgac
atgcgctccgccatggacgaataa

DBGET integrated database retrieval system