KEGG   Alcanivorax dieselolei: B5T_02633Help
Entry
B5T_02633         CDS       T02259                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B5T_02633 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5T_02633 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B5T_02633 (trpB)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B5T_02633 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2926066..2927277)
Genome map
AA seq 403 aa AA seqDB search
MTERPDYKAFPDQRGHFGQFGGRFVSETLMAALDELETMYRRLKDDPQFQADFDYDLAHY
VGRPSPLYLAERWSEQLGGARVWLKREDLNHTGAHKVNNTIGQALLAKHMGKKRVIAETG
AGQHGVASATVAARLGLECHVFMGEEDIRRQRLNVYRMKLLGADVIPVTSGSRTLKDAMN
EAMRDWVTNVDDTFYIIGTVAGPHPYPMLVRDFQSVIGREAREQSLKQAGKLPDALVACV
GGGSNAIGLFHPFLEDEGVAMYGVEAAGDGVDTGRHAAPLTAGRPGVLHGNRTYLMEDEN
GQIIETHSVSAGLDYPGVGPEHSWLKDIGRVNYVAADDQEALAAFRELTRVEGIMPALES
AHALAYARKLAPTMSADQNLIVNLSGRGDKDILTVADIDGIEF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaacgtcctgattacaaggcattccccgaccagcggggccacttcgggcaattc
ggcggacggttcgtctccgaaaccctgatggccgctttggacgaactggaaaccatgtac
cggcgtctcaaggatgacccccaattccaggccgatttcgattacgacctggcccactac
gtggggcgtccttcgccgttgtatctggcggaacgctggagcgaacagctcggcggcgcc
cgcgtctggctcaagcgtgaggatctcaatcacaccggcgcgcacaaggtgaacaacacc
atcggccaggccttgctggccaaacacatgggcaagaagcgggtgatcgcggaaaccggt
gccggtcagcacggggttgcttccgccaccgtggccgcccggctggggctggagtgtcac
gtgttcatgggcgaggaagacattcgccggcagcggctcaacgtctaccgcatgaaactg
ctcggcgccgacgtgattccggtgacctccggctcacgcaccctcaaggacgccatgaac
gaagccatgcgcgactgggtcaccaacgtggacgacaccttctacatcatcggcaccgtg
gccgggccgcacccgtacccgatgctggtgcgggacttccagtcggtgatcggccgcgag
gcccgtgagcagagtttgaaacaggccggcaagctgccggacgcgctggtcgcctgtgtc
ggcggcggctccaacgccattggcctgttccacccgttcctggaggacgagggcgtggcc
atgtacggcgtggaagccgccggtgatggcgtcgacaccggccgccacgcggcgccgctt
accgccgggcgccccggtgtgctgcacggcaaccgcacctatttgatggaagacgagaac
ggccagatcatcgagacccactcggtgtccgccggtctggattatccgggggtcggcccc
gagcattcctggctcaaggacatcggccgggtcaattacgtggccgccgacgaccaggaa
gcgctggccgcgttccgcgagctgacccgggtggagggcatcatgccggcgctggaatcc
gcccacgcgctggcctatgcgcgcaagctggcgcccaccatgagcgcggaccagaatctc
atcgtcaatctgtccggacggggtgacaaggatatcctgaccgtggccgacatcgacggc
atcgagttttga

DBGET integrated database retrieval system