KEGG   Alcanivorax dieselolei: B5T_02682Help
Entry
B5T_02682         CDS       T02259                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00020  Citrate cycle (TCA cycle)
adi00310  Lysine degradation
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
Module
adi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5T_02682 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    B5T_02682 (sucB)
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B5T_02682 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_60s GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFT70952
UniProt: K0CGS7
Position
complement(2978853..2980073)
Genome map
AA seq 406 aa AA seqDB search
MATDIKAPQFPESVADGTVATWHKKEGEAVKRDELLVDIETDKVVLEVVAPMDGVLTKII
KGEDTTVESQEVLGQLEAGASASASAAAEEKPQAEAPAAEAQSGDDDGDAQAGPAARKLM
SEHGLSAADVKGTGAKGRITKDDVEKALANKQQSQPASGGAPAPAAAPAPAAGEREERRV
PMTRLRKRIAERLVAAQQDAAMLTTFNEVNMKPIMDMRKHYQSEFEKSHGVRLGFMSFFT
RACVEALKRFPAVNASIDGDDIVYHGYYDVGMAVSSDRGLVVPVMRDADQKGLAEIESQI
IEFGTKARDGKLSIEDMTGGTFTISNGGVFGSLLSTPILNPPQTAILGMHKIQERPMAVD
GEVKILPMMYLALSYDHRIIDGKEAVQFLVAVKNFIEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagatatcaaagccccgcaatttccggaatccgtggccgatggcacggtagcc
acctggcacaagaaagaaggcgaggcggttaaacgcgacgagctgctggtggacatcgag
accgacaaggtggtcctcgaagtagtggctccgatggacggtgtgctgaccaagatcatc
aagggcgaagacaccaccgtggaaagtcaggaagtgctcggacagttggaagcaggcgcc
agtgcgtccgcctccgctgccgctgaagaaaaaccgcaagccgaggcgccggccgccgaa
gcacaaagcggtgacgatgatggcgacgctcaggccgggccggccgcgcgcaagctgatg
agcgagcacggtctcagtgccgcggacgtcaaaggcaccggcgccaagggccgcatcacc
aaggacgacgtggaaaaggcgctggccaacaagcagcagagccagcccgcttccggcggt
gcgcccgcgccggcggcggctcccgccccggccgccggcgagcgcgaggaacgccgcgta
ccgatgacccgcctgcgcaagcgcatcgccgaacggctggtggcggcgcagcaggacgcg
gccatgttgaccaccttcaacgaggtcaacatgaaaccgatcatggacatgcgcaagcac
tatcaaagcgagttcgagaagtcccacggcgtgcgcctgggcttcatgagcttcttcacc
cgcgcctgcgtggaagcgctgaaacgcttcccggcggtgaatgcgtccatcgacggtgac
gacatcgtctaccacggttactacgacgtgggcatggcggtgtcttccgatcgtggtctg
gtggtgccggtaatgcgcgacgccgaccagaaagggctggccgaaatcgaatcccagatc
atcgagttcggtaccaaggcccgggacggcaagctgtccatcgaggacatgaccggcggt
accttcaccatctccaacggcggtgtcttcggctcgctgctgtccacgccgatcctcaac
ccgccgcaaaccgccatcctgggtatgcacaagatccaggaaagaccgatggcggtggat
ggcgaagtgaagattctgccgatgatgtatctggcgttgtcctatgaccaccggatcatc
gacggcaaggaagcggtgcaattcctggtcgccgtgaagaacttcatcgaggatccggca
cggctgctgctggacatctga

DBGET integrated database retrieval system