KEGG   Alcanivorax dieselolei: B5T_02686Help
Entry
B5T_02686         CDS       T02259                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
adi  Alcanivorax dieselolei
Pathway
adi00020  Citrate cycle (TCA cycle)
adi00190  Oxidative phosphorylation
adi00650  Butanoate metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
Module
adi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5T_02686 (sdhD)
   00650 Butanoate metabolism
    B5T_02686 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    B5T_02686 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFT70956
UniProt: K0CH39
Position
complement(2985985..2986365)
Genome map
AA seq 126 aa AA seqDB search
MVTRVTSVTSLGRNGLYDWLIQRVSAVVIGVYFIGMLGYLIAQPNLDYGTWKAFIGSVPM
QIATTLLVLSVAAHTWVGLWGVTTDYLTGMTLGKSATCVRLVVQMVIALLLMVYVLWGLV
TIWGGA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtaacccgggtaaccagcgtcaccagtctgggccgtaacggcctgtacgactggctg
attcagcgcgtcagcgccgttgttatcggcgtgtacttcatcggcatgttgggctatctg
atcgcccagccgaatctcgactatggcacctggaaggccttcatcggctccgtgccaatg
caaatcgccaccaccttgctggtactttccgtggccgcccacacctgggtcggtctgtgg
ggtgtgaccaccgactatctcaccggcatgaccctgggcaaatccgccacctgtgtacgc
cttgtcgtgcagatggtgattgctctgctactgatggtctacgtcctttggggcctggta
acgatttggggaggcgcttga

DBGET integrated database retrieval system