KEGG   Alcanivorax dieselolei: B5T_02905Help
Entry
B5T_02905         CDS       T02259                                 

Gene name
fadB3
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
adi  Alcanivorax dieselolei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B5T_02905 (fadB3)
   01212 Fatty acid metabolism
    B5T_02905 (fadB3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B5T_02905 (fadB3)
   00650 Butanoate metabolism
    B5T_02905 (fadB3)
  Lipid metabolism
   00071 Fatty acid degradation
    B5T_02905 (fadB3)
   01040 Biosynthesis of unsaturated fatty acids
    B5T_02905 (fadB3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_02905 (fadB3)
   00310 Lysine degradation
    B5T_02905 (fadB3)
   00380 Tryptophan metabolism
    B5T_02905 (fadB3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5T_02905 (fadB3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5T_02905 (fadB3)
   00281 Geraniol degradation
    B5T_02905 (fadB3)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B5T_02905 (fadB3)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B5T_02905 (fadB3)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B5T_02905 (fadB3)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B5T_02905 (fadB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3222744..3224924)
Genome map
AA seq 726 aa AA seqDB search
MNEQTLNDKESTIRWEQDADNIVTLVLDDPKQSANTMNERYMRSMAATVERLEKEKDNIT
GVIITSAKSTFFAGGDLNDLIQVTPERAAEFSAGVETAKAQLRTLETLGIPVVAALNGTA
LGGGLEIALSCHHRIALNNPKAVFGLPEVTLGLLPGGGGVVRTVRMLGIQNALMQVLLQG
QRHKVDKAKALGLVDEVVDTPEAMLEQARAWIKANPKAKQPWDEKGYKIPGGSPSNPGFA
QNLPAFPANLRKQLKGANYPAPRNILAAAVEGAQVDFDNAIKIEGRYFVELACGQVAKNM
TTAFFFNLQAINAGASRPKDVPKYKAQKVAVLGAGMMGAGIAYVTARSGAEVVLKDVSLE
NAEKGKAYSEKLLDKAVSKGGMSKEKKEEILARITPSADVKDLQGVDFVVEAVFENTDLK
HKVFQEIEDVVNADAVLGSNTSTLPITGLAEGVKKQDNFIGIHFFSPVDKMPLVEIIRGE
NTSDEVLAKVFDYTLQINKTPIVVNDSRGFFTSRVIGTFINEAIAMVGEGQNANSIEQAA
TQAGYPVGALKLIDEINMKLSLKIAGEYKQAAQAQGGSPQAHPALAVMEKMVNQLDRPGK
LDGKGFYEYPDNGKAHLWAGLKEQFPAREAIPFRDMQERMLFAEALETVKCFQEGVIESV
GDTNIGSIFGIGFPAWSGGVVQYMNQYEGGLRGFVARAEELADRYGERFNPPPLLVEKAE
KGEIFK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcaaacccttaacgacaaagaaagcaccatccgctgggaacaggacgcggac
aatatcgtcaccctggtcctggatgatcccaagcaatccgccaataccatgaacgagcgc
tacatgcgctccatggccgccaccgtcgagcggctggaaaaagaaaaggacaacatcacc
ggggtgatcattacctcggcgaagagcaccttctttgccggcggcgatctgaacgatctg
atccaggtaacgccggagcgggcggcggaattttccgccggtgtggaaaccgccaaggca
cagctgcgtaccctggaaaccctggggattccggtggtggccgcgttgaacggcaccgcc
ctgggcggcggtctggaaatcgccttgtcctgtcatcaccgtatcgcgctgaacaatccg
aaagcggtattcggtctgccggaggtgaccctggggctgttgcccggtggcggcggtgtg
gtacgcaccgtgcgcatgctggggattcagaacgctctgatgcaggtcctgctgcaaggc
cagcgccacaaggtggacaaagccaaggcgctgggtcttgtcgacgaagtcgtggatacc
ccggaagcgatgctggaacaggcccgtgcctggatcaaagccaaccccaaggccaaacag
ccctgggacgagaaaggctacaagattcccggcggttcgccgagcaaccccggtttcgcg
cagaacctgccggcgttccccgccaatctgcgcaagcagctcaaaggcgccaattatccg
gcaccgcgcaatatcctggcggcggcggtggaaggcgcccaggtggacttcgacaatgcg
atcaagatcgagggccgttacttcgttgagctggcttgcggtcaggtggcgaagaacatg
accaccgcctttttcttcaatctgcaggccatcaacgccggcgccagccgtcccaaggat
gtgccgaaatacaaagcgcaaaaagtggcggtgctcggtgccggcatgatgggcgcgggg
atcgcctacgtcaccgcccgttccggtgccgaggtggtgctcaaggatgtttctctggag
aacgcggagaaaggcaaggcgtactccgagaagctgctggacaaggcggtgtccaagggc
gggatgagcaaggaaaagaaagaagaaatccttgcccgtattacgccctccgctgacgtt
aaagatctgcaaggcgtggacttcgtcgtcgaagccgtgttcgaaaacaccgacctgaag
cacaaggtgttccaggaaatcgaggacgtggtcaatgcggacgcggtgctgggctccaac
acctcgacgctgccgatcaccggcctggcggaaggggtgaagaaacaggacaacttcatc
ggcatccatttcttcagcccggtggataaaatgccgctggtggaaatcatccgtggtgag
aacaccagcgacgaagtgctggccaaggtgttcgactacactctgcaaatcaacaagacg
ccgatcgtggtcaacgactcccgcggcttcttcaccagccgggtgatcggcaccttcatc
aacgaagccatcgccatggtcggcgaagggcagaacgccaactccattgagcaggccgcc
actcaggccggctatccagtgggcgcgctcaagctgatcgatgagatcaacatgaagctg
tccctgaagattgccggtgagtacaagcaggcggcgcaggcgcagggcggtagcccccag
gcccatcccgcgctggcggtgatggagaaaatggtcaaccaactggatcgccccggcaag
ctggatggcaagggcttttatgaatatccggataatggcaaggcgcacctttgggccggt
ttgaaggagcagttcccggcccgggaagctattccgttccgggatatgcaggagcggatg
ctgttcgccgaagccctggaaacggtcaagtgcttccaggaaggggtgatcgagtccgtt
ggcgataccaacattggttccatctttggcattggttttccggcctggtccggcggtgtg
gtgcagtacatgaaccagtacgagggtggtctgcgcggcttcgtggcccgtgccgaggaa
ctggccgatcgctacggtgagcgtttcaatccgccgccgctgctggtggaaaaagcggag
aaaggcgagatcttcaaatag

DBGET integrated database retrieval system