KEGG   Alcanivorax dieselolei: B5T_03131Help
Entry
B5T_03131         CDS       T02259                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00071  Fatty acid degradation
adi00280  Valine, leucine and isoleucine degradation
adi00281  Geraniol degradation
adi00310  Lysine degradation
adi00360  Phenylalanine metabolism
adi00362  Benzoate degradation
adi00380  Tryptophan metabolism
adi00410  beta-Alanine metabolism
adi00627  Aminobenzoate degradation
adi00640  Propanoate metabolism
adi00650  Butanoate metabolism
adi00903  Limonene and pinene degradation
adi00930  Caprolactam degradation
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01212  Fatty acid metabolism
Module
adi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B5T_03131
   00650 Butanoate metabolism
    B5T_03131
  Lipid metabolism
   00071 Fatty acid degradation
    B5T_03131
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_03131
   00310 Lysine degradation
    B5T_03131
   00360 Phenylalanine metabolism
    B5T_03131
   00380 Tryptophan metabolism
    B5T_03131
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5T_03131
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5T_03131
   00281 Geraniol degradation
    B5T_03131
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5T_03131
   00627 Aminobenzoate degradation
    B5T_03131
   00930 Caprolactam degradation
    B5T_03131
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B5T_03131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFT71398
UniProt: K0CFG4
Position
complement(3471974..3472888)
Genome map
AA seq 304 aa AA seqDB search
MLELTTVRISQDERNPRIARLLLNRPERLNAIIDETGDDIRRAVRWAEENDQVHVIVVEG
AGKGFCGGYDLTYYAESQRENPCQQEATPWDPMVDYAHMKRNTEDFMSLWRSRKPTIAKI
HGAAAAGGSDIALCCDLMIMADNARIGYMPTRVWGCPTTAMWTYRLGPIRAKQMMFTGDL
ISGKQAGEWGLANYVVPEEELDAKTMEVAGRIAGVPSSHLSMHKLVVNQVMLTMGLEQTQ
MLATVFDGITRHNPEGLWFRRYAQTEGFKAAIEWRDSGRDIPEGDDARRKIAELEQKLKE
LKGE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctggaattgacaactgtccggatttcccaggatgagagaaacccgagaatcgctagg
ctgctcctcaatcgtccggaaagactcaatgccatcatcgatgaaaccggtgacgatatt
cggcgcgcggtaaggtgggcggaagagaacgaccaggtccacgtgattgtcgttgaaggc
gccggcaaagggttttgcggcggttacgatctgacctactacgcggaatcacaaagagag
aatccttgtcagcaggaagccactccctgggatcccatggtcgactacgcccatatgaag
cggaacaccgaggatttcatgagtctttggcggtcccgtaaacccaccatcgccaagatt
catggcgccgccgccgctggcggaagtgatattgccttgtgttgtgacttgatgatcatg
gccgataacgcccgtatcggttacatgcccacccgggtttggggatgcccgacgaccgcc
atgtggacctatcggctcgggccgatccgggccaagcagatgatgttcaccggggatctg
atttccggcaagcaggccggcgaatggggcctggccaactatgtggtgccggaagaggaa
ctggacgccaagaccatggaagtggcggggcgcattgccggggtaccaagcagtcatctg
agcatgcacaagctggtggtgaatcaggtcatgttgaccatgggcttggagcagacccag
atgctggccacggtgttcgatggcattacccgccacaatccggaaggtctctggttccgt
cgttatgctcagacggaaggattcaaagcggccatcgaatggcgcgacagcggccgcgac
attcccgaaggcgacgacgcgcgccgcaagatcgccgagctggaacaaaagttgaaggaa
ctcaagggagagtga

DBGET integrated database retrieval system