KEGG   Alcanivorax dieselolei: B5T_03149Help
Entry
B5T_03149         CDS       T02259                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
adi  Alcanivorax dieselolei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:adi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B5T_03149 (recD)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B5T_03149 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3496420..3498366
Genome map
AA seq 648 aa AA seqDB search
MRSDGQGDLFAAVDWQSALEQVRDQGQLRDLDVAVARFLHQQAPDTDPVVLVIAALTSAQ
LAAGHLCLDLEEPELAQRLWPAGIPESLVPLLPPDPQQWHAPLRASELVGEGSGQPLVLD
GSRLYLQRNWTQEVKVADLLLARLRHETSAPPGDTLAKLFVDGDDEVDWQQVACALATRA
RLTVITGGPGTGKTTTVVRLLGLLQSLALEQGRTLRIRLAAPTGKAATRLTQSIGDQVAR
LPLPQTVRSAIPTEVSTLHRLLGTRPDSRRFRHHRHNPLHADLVVVDEASMIDMEMMASL
LDALDANTRLVLLGDKDQLASVEAGAVLGDLCRDADRGGYDETTVDFIQQNCGADLTAWR
GDGGPLAQQTAMLRRNWRFRDSPGIGALARAVNQGDNRSVTSVFRQHTDQLQRLDLRRDP
HYLHRFLIDGTASHPGLKALLLEAANTPDRDELDSWAARLLLRLTERQLLSGLRGGPFGV
TELNQQLTRQLHRQGLADEHEWYPGRPVMLTHNDYQLGLMNGDVGLTLAHPDGLRVAFPL
PDGRIKWVLPSRLGGVETVYAMTVHKSQGSEFRHTLLILPDRPHPLLTRELIYTAVTRAR
ETFTLLECGPGTVLNQAVARRTWRASGLWQRLNRTERQVITDDDDSCR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagtgatggacaaggcgatctgttcgccgccgtcgactggcaaagtgccctggag
caagtgcgcgatcaggggcagttacgggatctggacgtggcggtggcgcggtttctgcac
cagcaggcaccggacaccgatccggtggtcctggtgatcgccgcgctcaccagcgcgcaa
ctggcggcggggcatctgtgtctggacctggaggaaccggagttggcccaacggctatgg
ccggcgggcataccggagagtctggtgccgttattgccgccggacccgcaacagtggcac
gcaccgctgcgagccagtgagctggttggcgagggctccggtcagcccctggtgctggac
ggttcccgtctctacctgcagcgcaactggacccaggaggtcaaggtcgccgacttactg
ctggcgcgactgcggcacgagacttccgcccctccgggcgacactctggcaaagctgttc
gtcgacggcgatgacgaggtggactggcagcaggtggcctgcgccctggccacccgtgcc
cgcttgacggtgatcaccggcggccccggcaccggcaagaccaccaccgtggtgcgcctg
ctgggtctgctgcaaagcctggcactggaacagggacgcaccctgcgtatacgtctggcc
gcccccaccggcaaggccgccacccggctgacgcagtccatcggcgatcaggtggcgcgg
ctgccgttgccgcaaaccgtgcgctcggccattcccaccgaggtcagcactctgcaccgc
ctgctcggcacccgccctgacagccgccgcttccgtcatcaccggcataacccgctgcac
gcggatctggtggtggtggacgaagccagcatgatcgacatggaaatgatggccagtctg
ctcgacgccctggatgccaatacccggctggtgctgctgggcgacaaggaccaactggcc
agcgtggaagccggcgcggtcctcggtgacctttgccgcgacgccgatcggggcggctac
gacgagaccacggtggacttcattcaacaaaactgcggcgccgacctgaccgcctggcgc
ggcgacggcggccccttggcgcaacagaccgccatgctgcgacgcaactggcgcttccgc
gacagccccggcatcggcgcactggcccgggcggtgaatcaaggtgataaccggagtgtc
accagcgtcttccgacaacatacggatcaactacagcgcctggacctgcgccgcgatccc
cactatctgcaccgtttcctgatcgacggcacggcctcgcatccggggttgaaagcgctg
ctgctcgaagcggccaacacaccggacagggacgaactggatagctgggccgcccggctg
ctgctccggttaaccgagcggcagttgttgagcggcttgcgcggcggccctttcggcgtc
accgagctgaatcagcaactgacccggcaactgcaccggcagggcctggcggacgagcac
gaatggtatccgggccgtccggtgatgcttactcacaacgattatcagcttggtctgatg
aacggcgacgttggcctgaccctggcccacccggatggcctgagagtggcatttccgtta
ccggatggccgcatcaagtgggtattgccgagccggctgggcggcgtggaaacggtctac
gcgatgaccgtgcacaaatcccagggctcggagttccgacacaccctgctgatccttcca
gaccggccgcatccgctgctaacccgggagctgatctataccgcggtgacccgggcgcgg
gagaccttcaccctgctcgagtgcggcccgggcacggtgctgaaccaggcggtcgcccgc
cgcacctggcgcgcatcggggttatggcaacgactgaaccgcaccgaacggcaggtcatc
accgatgacgacgactcttgccgctga

DBGET integrated database retrieval system