KEGG   Alcanivorax dieselolei: B5T_03232Help
Entry
B5T_03232         CDS       T02259                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
adi  Alcanivorax dieselolei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:adi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B5T_03232 (ruvA)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B5T_03232 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598900..3599502)
Genome map
AA seq 200 aa AA seqDB search
MIGQLKGQLLDKRPPWLLLDVGGVGYEVEAPMTVFYDMPEVGASLTLHTHFVVREDAQLL
YGFNSRYERELFRSLIKVNGVGPKMALAILSGIEADRLAACIRDQDTSSLVKVPGIGKKT
AERLVIEMSDRLDKLEGAPAMPSGLVSQAGANGVRDDAVAALEALGYRNKDAVAAVARAA
EAGEETSEGLIRRALRGLAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacaactcaaaggacaactgctggacaaacggccgccctggctgctgctggat
gtgggtggtgttggctacgaagtggaagcgccgatgacggtgttctatgacatgccggaa
gtcggggcgtcgttgacactgcatacccatttcgtggttcgcgaggatgcccaactgctg
tacggcttcaacagccgttatgagcgcgagctgttccgcagcctgatcaaggtcaacggt
gtcggcccgaaaatggcgctggcgattctctccggcatcgaagcggatcggctggccgcc
tgtatccgtgatcaggacaccagctccctggtgaaggtgccgggtatcggcaagaaaacc
gccgagcgtctggttatcgagatgtccgatcgcctggacaagctggaaggcgcgccggcg
atgccgtcggggctggtgtcccaggccggcgccaatggcgttcgtgacgacgcggtggcg
gcgctggaagctctgggctatcgcaataaggacgcggtggcggcggtggcccgcgcggcg
gaggccggggaggagaccagcgaaggtcttattcgccgggctctgcgtggtctggcaaag
tga

DBGET integrated database retrieval system