KEGG   Alcanivorax dieselolei: B5T_03382Help
Entry
B5T_03382         CDS       T02259                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00630  Glyoxylate and dicarboxylate metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01200  Carbon metabolism
Module
adi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B5T_03382 (aceA)
Enzymes [BR:adi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     B5T_03382 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFT71649
UniProt: K0CDG3
Position
complement(3774445..3776046)
Genome map
AA seq 533 aa AA seqDB search
MSQYLKEIEALSSVVGANNTWHDINPESAVRMRLQNRFKTHLDIAKYNAKIMREDMAAYD
ADTSKYTQSLGCWHGFIGQQKLISIKKHFGSTKGRYLYLSGWMVAALRSEFGPLPDQSMH
EKTVVADLIRELYTFLKQADAWELNHLFRALDDAKAAGDEAKQAEIISQIDNFETHVVPI
IADIDAGFGNPEATYLMAKQLIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKIN
AVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDQYNAFLDGDIIESAADIN
NGDVVIKSNGKLLKPKRLASGLFQFKAGSGIDRVVLDCITSLQNGADLLWIETEKPHVGQ
IAEMVNRIREVVPDAKLVYNNSPSFNWTLNFRQQVFDAWEKEGKDVSAYDRDRLMSADYD
STELAQLADEWTRNFQRDASREAGIFHHLITLPTYHTAALSTDQLAKGYFGDEGMLAYVA
GVQRREIREGVATVKHQDMAGSNIGDDHKEYFSGEAALKAGGKDNTMGQFENI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtacctcaaagagatcgaagcactgagctccgtggttggtgccaataacacc
tggcacgacatcaacccggaatccgctgttcgcatgcgcctgcaaaaccgcttcaaaacg
catctggacatcgccaagtacaacgccaagatcatgcgcgaagacatggcggcctacgat
gcggacacctccaagtacacccagtccctgggttgctggcacggtttcattggtcagcag
aagctgatttccatcaagaagcactttggcagcaccaaaggccggtacctgtacctgtcc
ggctggatggtcgcggccctgcgttccgagttcggtccgctgccggatcagtccatgcac
gagaagaccgtggtggccgacctgatccgcgaactgtacaccttcctcaagcaggccgac
gcctgggaactgaaccatctgttccgtgccctggacgacgccaaagctgctggtgatgag
gctaaacaggccgagatcatcagccagatcgacaacttcgaaacccacgttgtgccgatc
atcgccgacatcgatgctggcttcggtaacccggaagccacctacctgatggccaagcag
ctgatcgaagccggtgcttgctgtatccagatcgagaaccaggtttccgacgagaagcag
tgtggtcaccaggacggtaaagtgaccgttccccacgccgacttcctggccaaaatcaat
gccgttcgctacgccttcctcgagctgggcgttgacgacggcgtgattgttgcccgtacc
gactccctgggcgctggcctgaccaagcagatcgccgtgaccaacgagccgggcgacctg
ggcgaccagtacaacgccttcctggatggcgacatcattgaaagcgccgccgacatcaac
aacggcgacgtggtgatcaagtccaacggcaagctgctcaagccgaagcgtctggcttcc
ggtctgttccagttcaaagccggctccggtattgaccgcgtggttctggactgtatcacc
agcctgcaaaacggcgccgatctgctgtggatcgaaaccgagaagccgcacgtgggccag
atcgcggaaatggtgaaccgtatccgtgaagtggtgccggacgccaagctggtgtacaac
aacagcccgtccttcaactggaccctgaacttccgtcagcaagtgttcgacgcttgggag
aaggaaggcaaggacgtgtccgcttacgaccgcgaccgcctgatgagtgccgactacgac
agcaccgagctggctcagctggccgatgagtggacccggaacttccagcgcgacgcgtct
cgcgaagcgggtatcttccaccacctgatcacgctgccgacctaccacaccgctgctctg
tccaccgatcagctggccaagggttacttcggcgacgaaggcatgctggcctatgtagct
ggcgtacagcgccgcgagatccgcgaaggcgttgccaccgtgaagcaccaggacatggcc
ggttccaacatcggtgatgaccacaaagagtacttctccggtgaagccgcgctgaaagcc
ggtggtaaagacaacaccatgggtcagttcgagaacatctaa

DBGET integrated database retrieval system