KEGG   Alcanivorax dieselolei: B5T_03493Help
Entry
B5T_03493         CDS       T02259                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetases subfamily
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
adi  Alcanivorax dieselolei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:adi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:adi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3890143..3891615)
Genome map
AA seq 490 aa AA seqDB search
MITLGQLLTDLALPADLAGLPVMALRLDSRAVRPGDVFLAVPGFRADGRSYIGAAVEAGA
GAILQEGDAFTVNQSGAVPRIEIPALGREVGTLAARFYGCPANHLNIVGVTGTNGKTSIT
WFLRDALDAVGHRCGLVGTLGVGLKGDEADTGHTTPDPITLQSALYGLREKGADYVAMEV
SSHALDQGRLGDTRVPCAVFSNLSRDHLDYHGSMDAYLNAKRSLFTRPGLAMAVINTDDE
AASTLVASLDDGVRCVTFGSTDGATVRCLEHHALPEGMEMVLSVGGEPLSLRLPLYGDFN
LSNVMAVAGVLHGLGWSNQALGQGLGALTSVPGRMESLCQPGQPVVVVDYAHTPDGLEKA
LSGVRGHFPGRLWCLVGCGGDRDTGKRPLMGAVAEKLADRVVLTSDNPRNEAPEGIIEQI
RGGMNRPQDALCLSDRPEAVARAIAEAEAGDVVLIAGKGHERYQEVAGHRYPMDDRALAR
AALARRGGQA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctgggccaactgctgaccgatctggcattgccggccgacctggccggcttg
ccggttatggcgctgcggctggacagccgggcggtccgccctggtgacgtgttcctggcg
gtgcccggattccgtgccgatggccgcagttacatcggtgccgccgtcgaggccggggcc
ggggccatcctgcaggaaggcgatgcctttaccgttaaccagagtggcgcggtgccgcgc
atcgagattcctgccctggggcgtgaagtcggcaccctggcagcccgcttttacggctgt
cccgccaaccatctgaacattgtcggagtgaccggcaccaacggtaaaaccagcattacc
tggttcctgcgtgacgcccttgacgccgtcggccaccgctgtggtctggttggcaccctg
ggcgtggggctgaaaggggacgaagcggataccggccacaccacgccggacccgatcacg
ctgcagtcggcgttgtacggtctgcgggaaaaaggcgccgattacgttgccatggaagtg
tcctcccatgctctggatcaggggcgcctgggggacacccgggtgccctgcgcggtgttc
agcaatctcagccgcgaccatctggattaccacggcagcatggacgcctatctgaacgcc
aagcgttctctgttcacccgtccggggctggccatggcggtgatcaacaccgacgacgag
gccgcttccacgctggtggccagccttgatgatggtgtgcgttgcgtgacctttggatcc
accgatggcgccaccgtgcgttgtctggaacatcatgccctgccagaaggcatggaaatg
gtattgagcgtgggtggcgagccgttgtccctgcgtctgccgctgtacggcgacttcaac
ctgagcaatgtgatggcggtggccggtgtactgcacggattgggctggagcaaccaggcg
ctgggtcaaggactgggcgcgctgacctcagtgcccgggcggatggaatccctgtgccag
ccggggcagccggtggtggtggtggattatgcccatacaccggacggtctggagaaagcc
ctgagcggcgtgcgcggtcatttccccggccggctgtggtgcctggtgggttgcggcggt
gaccgtgacaccggcaagcgcccgctgatgggcgcggtggcggaaaaactggccgatcgc
gtggtgctcaccagtgataatccgcgcaatgaagcgccggaaggcatcatcgaacaaatc
cgcggtggcatgaaccggccgcaagatgcgctatgcctgagcgaccggcccgaagccgtg
gccagggccatcgccgaggccgaggccggtgacgtggtgctgatcgccggcaagggccac
gaacgttatcaggaagtggccggccatcgttatcccatggacgaccgggccttggcccgg
gcggcgctggcacgccggggagggcaggcatga

DBGET integrated database retrieval system