KEGG   Alcanivorax dieselolei: B5T_03566Help
Entry
B5T_03566         CDS       T02259                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
adi  Alcanivorax dieselolei
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:adi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3964919..3966220)
Genome map
AA seq 433 aa AA seqDB search
MKTNWLDAGDSDFVERLTALTAWSEERDEEVAERVRGILKDVAQRGDQAVIDYTNRFDRR
QVTSMAELTVNREQLLAALERIPVALREALEAAARRVRAYHEKQKQDSWQYRDEHGSLLG
QQVTPLDRVGIYVPGGKAAYPSSVLMNALPAHVAGVGEIVMVSPAPDGELNDVVLAAAAV
AGVERFFTLGGAQAVAALAHGTDTVPAVDKIVGPGNIYVAEAKRQVFGKVGIDMIAGPSE
ILVVCDGKTDPEWIAMDLFSQAEHDEEAQSILVSPDADFLKRVDAAMDRLAPTLEREDII
RTSMANRGALIQVADLGQALDVVNRISPEHLELSMDDAEAWARKVRHAGAIFLGRHTPEA
LGDYCAGPNHVLPTSATARFSSPLGVYDFQKRSSLIGCSPEGASELGRIASVLARGESLT
AHARSAEYRIKES
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaactggctggacgcgggtgacagcgatttcgtcgagcgtttgacggcgctc
accgcctggtcggaggaacgcgacgaggaagtggccgagcgcgtgcgcggcatcctcaag
gatgttgcccagcgtggtgaccaggcggtgatcgactacaccaaccggttcgaccgccgg
caagtgacctccatggcggaactgaccgtgaaccgggagcaactgctggcggcgctggag
cggatccccgtggccctgcgggaagctctggaggcagccgcccggcgggtgcgcgcttac
cacgaaaagcagaagcaggattcctggcagtatcgggacgaacacggctcgttgttgggg
cagcaggtcacgccgctggatcgggtcggcatctacgtgcccggtggcaaggccgcctat
cccagctcggtactgatgaatgcgctgccggcccacgtggccggagtgggcgaaatcgtc
atggtcagcccggcgccggacggtgaactgaacgatgtggtgctggcggcggcggcggtg
gccggtgtcgaacgcttctttaccctgggcggcgcccaggcggtggcggccctggcccac
ggcacggacacggtgccggcggtggacaagatcgtcgggcccggcaacatctatgtggcg
gaagccaagcgccaggtgttcggcaaggtgggcatcgacatgatcgccggcccgtccgag
attctggtggtgtgcgacggcaaaaccgatcccgagtggatcgccatggacctgttttcc
caggccgaacacgacgaggaagcgcagtcgattctggtcagcccggacgcggatttcctc
aagcgggtggacgccgccatggaccgcctggcgccgaccctggaacgggaagatatcatc
cgcacctccatggccaaccgcggtgccctgattcaagtggcggacctgggtcaggccctg
gacgtggtcaatcgcatcagtcccgaacacctggaattgtccatggacgacgccgaggcc
tgggcgcgcaaggtgcgccatgccggcgctattttcctcggacgccatacgccggaggca
ctgggcgactactgcgcgggccccaatcacgtgctgccgaccagcgccacggcccggttc
tcctctccgttgggcgtgtacgatttccagaaacgcagttccttgatcggctgctccccg
gaaggggccagcgagttggggcgtatcgcctccgttctggcgcggggcgagagtctgacc
gcccatgcccgcagcgccgaataccgcatcaaggagagctaa

DBGET integrated database retrieval system