KEGG   Alcanivorax dieselolei: B5T_03566Help
Entry
B5T_03566         CDS       T02259                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00340  Histidine metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    B5T_03566
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     B5T_03566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFT71832
UniProt: K0CJE7
Position
complement(3964919..3966220)
Genome map
AA seq 433 aa AA seqDB search
MKTNWLDAGDSDFVERLTALTAWSEERDEEVAERVRGILKDVAQRGDQAVIDYTNRFDRR
QVTSMAELTVNREQLLAALERIPVALREALEAAARRVRAYHEKQKQDSWQYRDEHGSLLG
QQVTPLDRVGIYVPGGKAAYPSSVLMNALPAHVAGVGEIVMVSPAPDGELNDVVLAAAAV
AGVERFFTLGGAQAVAALAHGTDTVPAVDKIVGPGNIYVAEAKRQVFGKVGIDMIAGPSE
ILVVCDGKTDPEWIAMDLFSQAEHDEEAQSILVSPDADFLKRVDAAMDRLAPTLEREDII
RTSMANRGALIQVADLGQALDVVNRISPEHLELSMDDAEAWARKVRHAGAIFLGRHTPEA
LGDYCAGPNHVLPTSATARFSSPLGVYDFQKRSSLIGCSPEGASELGRIASVLARGESLT
AHARSAEYRIKES
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaactggctggacgcgggtgacagcgatttcgtcgagcgtttgacggcgctc
accgcctggtcggaggaacgcgacgaggaagtggccgagcgcgtgcgcggcatcctcaag
gatgttgcccagcgtggtgaccaggcggtgatcgactacaccaaccggttcgaccgccgg
caagtgacctccatggcggaactgaccgtgaaccgggagcaactgctggcggcgctggag
cggatccccgtggccctgcgggaagctctggaggcagccgcccggcgggtgcgcgcttac
cacgaaaagcagaagcaggattcctggcagtatcgggacgaacacggctcgttgttgggg
cagcaggtcacgccgctggatcgggtcggcatctacgtgcccggtggcaaggccgcctat
cccagctcggtactgatgaatgcgctgccggcccacgtggccggagtgggcgaaatcgtc
atggtcagcccggcgccggacggtgaactgaacgatgtggtgctggcggcggcggcggtg
gccggtgtcgaacgcttctttaccctgggcggcgcccaggcggtggcggccctggcccac
ggcacggacacggtgccggcggtggacaagatcgtcgggcccggcaacatctatgtggcg
gaagccaagcgccaggtgttcggcaaggtgggcatcgacatgatcgccggcccgtccgag
attctggtggtgtgcgacggcaaaaccgatcccgagtggatcgccatggacctgttttcc
caggccgaacacgacgaggaagcgcagtcgattctggtcagcccggacgcggatttcctc
aagcgggtggacgccgccatggaccgcctggcgccgaccctggaacgggaagatatcatc
cgcacctccatggccaaccgcggtgccctgattcaagtggcggacctgggtcaggccctg
gacgtggtcaatcgcatcagtcccgaacacctggaattgtccatggacgacgccgaggcc
tgggcgcgcaaggtgcgccatgccggcgctattttcctcggacgccatacgccggaggca
ctgggcgactactgcgcgggccccaatcacgtgctgccgaccagcgccacggcccggttc
tcctctccgttgggcgtgtacgatttccagaaacgcagttccttgatcggctgctccccg
gaaggggccagcgagttggggcgtatcgcctccgttctggcgcggggcgagagtctgacc
gcccatgcccgcagcgccgaataccgcatcaaggagagctaa

DBGET integrated database retrieval system