KEGG   Alcanivorax dieselolei: B5T_03862Help
Entry
B5T_03862         CDS       T02259                                 

Gene name
tpiA
Definition
triosephosphate isomerase 2
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B5T_03862 (tpiA)
   01230 Biosynthesis of amino acids
    B5T_03862 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_03862 (tpiA)
   00051 Fructose and mannose metabolism
    B5T_03862 (tpiA)
   00562 Inositol phosphate metabolism
    B5T_03862 (tpiA)
Enzymes [BR:adi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B5T_03862 (tpiA)
Exosome [BR:adi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B5T_03862 (tpiA)
  Exosomal proteins of bladder cancer cells
   B5T_03862 (tpiA)
  Exosomal proteins of melanoma cells
   B5T_03862 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4284040..4284789)
Genome map
AA seq 249 aa AA seqDB search
MTRTPLVAGNWKMNGRLDMVGALGASLSGLRNSRAEVAVCPPFPYLAPLVRALGDSGVQI
GAQNVSRHQDGAFTGEVSAEMLADLGCRYVIVGHSERRALYGEDDELVGEKFLRAQQGGL
IPILCVGETLREREAGETEQVVVRQVSSVLDVAGIGAFDQAVVAYEPVWAIGTGETATPE
QAQEVHARLRAALAAEDASVASRIRLLYGGSVKSDNAALLFAQPDIDGGLIGGASLSADE
FSAICLAAE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaacgccgctggtagccggtaactggaagatgaatggccggctggacatggtg
ggggctctgggggcttccctgagtggattgcggaacagccgggcagaagtggccgtgtgt
ccgccgtttccctatctggcgcctctggtccgcgctctgggcgacagcggggtgcaaatt
ggcgcgcaaaacgtgagccgccaccaggatggtgccttcactggcgaagtctccgcggag
atgctcgccgatctgggctgccgctacgtaatagtagggcattccgagcgccgcgccctg
tacggtgaagatgatgaactggtgggtgagaagtttcttcgtgcccagcagggagggttg
ataccgatcctgtgcgtcggtgaaacgctgcgtgaaagggaggcgggcgagaccgagcag
gtagtggtacggcaggtctcatcggtgctggacgtggctggcatcggcgctttcgaccag
gcggtggtggcttacgagccggtttgggcgatcggtaccggtgaaaccgccacccccgaa
caggcccaggaagtacacgcccgtttacgcgcggcgctggccgcggaggacgcaagtgtg
gcttcccgcatccggctgctttacggcggcagtgtaaagtcggataatgccgcccttctg
ttcgcccagccggatatagacggtggtcttatcggcggggcctcactgagcgcggatgaa
ttcagcgcaatttgtctcgcggcggaataa

DBGET integrated database retrieval system