KEGG   Alcanivorax dieselolei: B5T_03950Help
Entry
B5T_03950         CDS       T02259                                 

Definition
arginase protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B5T_03950
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B5T_03950
Enzymes [BR:adi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B5T_03950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4376330..4377226)
Genome map
AA seq 298 aa AA seqDB search
MLSLPALAAPSYLGGRRPERPWRPGDIRLTPLWRRLRQRHGLTLDWRGCLTPPDNASGPP
ALADYLSRLRDGVYNELSSGRPLFVLGGDHANAMAVWDAAMAAVGERRFGLLWIDAHLDC
HTFMTTPSGNVHGMPLAALLGLADPSLASLMPGRCRLRPEALCLFGVRSYERAEQEAMER
LNVRVIQAARVRRDGIDGALDGALAYLDRHCEHYGISIDLDAIHPRQAPAVATPVVGGLN
GSALCQALCRRVDPDRCRILEIAEFYPSLDRAGRTQRLLADLVGAWWWSRGSRRRGWA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgttacccgcgctggcggcgccgtcctatctgggtgggcggcgaccggaaagg
ccctggcggcccggagatatccgcttgacgccgttgtggcgaagactgcggcagcgccat
ggtctgacgttggactggcgcggctgtttaacgccaccggacaacgcgtccggcccgccc
gctctggccgattacctgagcagacttcgggacggcgtgtacaacgaactgagcagcggc
cggccattgttcgtgctcggcggcgatcacgccaacgccatggcggtgtgggacgccgcc
atggcggcggtcggtgagcgccgcttcggactgctgtggatcgatgcccatctggattgc
cataccttcatgaccaccccttcgggcaatgtgcatggcatgccgctggcggcgttgctg
gggctggcggatccgtcactggcgtcgctgatgcccggccgttgccggttgcggccggaa
gcactgtgtctgttcggggtgcgcagttatgagcgtgccgaacaggaagccatggagcgc
ctgaatgtccgagtgattcaggcggcccgggtgcgccgtgacggcatcgacggggctttg
gacggagcgctggcttacctggaccggcactgcgagcactatggaatcagcatcgatctg
gacgccatccatccgcgtcaggcgccagcggtggccacgcctgtggtcggtggcctcaat
ggttcggccttgtgccaggcgttgtgtcggagggtggatccggaccgctgccggatcctg
gaaatcgccgagttctacccgtccctggaccgcgctggccgcacccagcggctattggcg
gatctggtgggtgcctggtggtggtcccgcggcagccgacgccgtgggtgggcctga

DBGET integrated database retrieval system