KEGG   Alcanivorax dieselolei: B5T_03950Help
Entry
B5T_03950         CDS       T02259                                 

Definition
(GenBank) putative arginase protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00220  Arginine biosynthesis
adi00330  Arginine and proline metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01130  Biosynthesis of antibiotics
adi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    B5T_03950
   00330 Arginine and proline metabolism
    B5T_03950
Enzymes [BR:adi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B5T_03950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFT72212
UniProt: K0CKF3
Position
complement(4376330..4377226)
Genome map
AA seq 298 aa AA seqDB search
MLSLPALAAPSYLGGRRPERPWRPGDIRLTPLWRRLRQRHGLTLDWRGCLTPPDNASGPP
ALADYLSRLRDGVYNELSSGRPLFVLGGDHANAMAVWDAAMAAVGERRFGLLWIDAHLDC
HTFMTTPSGNVHGMPLAALLGLADPSLASLMPGRCRLRPEALCLFGVRSYERAEQEAMER
LNVRVIQAARVRRDGIDGALDGALAYLDRHCEHYGISIDLDAIHPRQAPAVATPVVGGLN
GSALCQALCRRVDPDRCRILEIAEFYPSLDRAGRTQRLLADLVGAWWWSRGSRRRGWA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgttacccgcgctggcggcgccgtcctatctgggtgggcggcgaccggaaagg
ccctggcggcccggagatatccgcttgacgccgttgtggcgaagactgcggcagcgccat
ggtctgacgttggactggcgcggctgtttaacgccaccggacaacgcgtccggcccgccc
gctctggccgattacctgagcagacttcgggacggcgtgtacaacgaactgagcagcggc
cggccattgttcgtgctcggcggcgatcacgccaacgccatggcggtgtgggacgccgcc
atggcggcggtcggtgagcgccgcttcggactgctgtggatcgatgcccatctggattgc
cataccttcatgaccaccccttcgggcaatgtgcatggcatgccgctggcggcgttgctg
gggctggcggatccgtcactggcgtcgctgatgcccggccgttgccggttgcggccggaa
gcactgtgtctgttcggggtgcgcagttatgagcgtgccgaacaggaagccatggagcgc
ctgaatgtccgagtgattcaggcggcccgggtgcgccgtgacggcatcgacggggctttg
gacggagcgctggcttacctggaccggcactgcgagcactatggaatcagcatcgatctg
gacgccatccatccgcgtcaggcgccagcggtggccacgcctgtggtcggtggcctcaat
ggttcggccttgtgccaggcgttgtgtcggagggtggatccggaccgctgccggatcctg
gaaatcgccgagttctacccgtccctggaccgcgctggccgcacccagcggctattggcg
gatctggtgggtgcctggtggtggtcccgcggcagccgacgccgtgggtgggcctga

DBGET integrated database retrieval system