KEGG   Alcanivorax dieselolei: B5T_04274Help
Entry
B5T_04274         CDS       T02259                                 

Gene name
gshPx
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
adi  Alcanivorax dieselolei
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:adi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:adi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4741771..4742262)
Genome map
AA seq 163 aa AA seqDB search
MSIYDYNAVTLDGEERSLADFKGKVLLIVNTASKCGFTPQYKGLQALYQRYKDRGLVVLG
FPCNQFGHQEPGDEVEIGAFCEKNYGVDFPMFAKIDVNGSDAHPLYRYLKSEAPGLLGSE
GIKWNFTKFLVDQSGRVVRRYAPKDKPEALAADIEKALKAVDS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctacgactataacgccgtcaccctggacggcgaggagcgctccctggccgat
ttcaaaggcaaggtgcttttgatcgtcaacaccgccagcaaatgcggttttacgccccag
tacaaagggctgcaggcgctgtatcaacgctacaaggatcgcggcctggtggtgttgggc
tttccctgtaaccagtttggtcaccaggagcccggcgatgaagtggagattggtgccttc
tgtgaaaagaactacggcgtcgactttcccatgttcgccaaaatcgacgttaacggcagc
gatgctcatcccctttatcgctacctcaaatcggaagcccccggcctgctcggcagcgaa
ggcatcaaatggaacttcaccaagttcctggtcgaccaaagcggccgtgtggtacgtcgc
tacgcccccaaggataaaccggaagcgttggcagcggacattgagaaggccttaaaagca
gttgacagttga

DBGET integrated database retrieval system