KEGG   Alcanivorax dieselolei: B5T_04283Help
Entry
B5T_04283         CDS       T02259                                 

Gene name
nosZ
Definition
nitrous oxide reductase apoprotein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
adi  Alcanivorax dieselolei
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    B5T_04283 (nosZ)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     B5T_04283 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4749929..4751836)
Genome map
AA seq 635 aa AA seqDB search
MTHDQFNDDNGNAQGEGLTRRGFLGAGTLGGAALAGAATLGGVVMTRETWASSVKEAMAK
AHVGPGELDEYYGFWSGGHSGEVRVLGVPSMRELLRIPVFNVDSATGWGLTDESKQVLGD
SARYLNGDSHHPHISMTDGRYDGKYLFINDKANSRVARVRLDIMKCDRILTVPNVQAIHG
LRLQKVPHTKYVFANAEFIIPHPNDGSSFDIQDDGSYTMFNAIDAERMEMAFQVIVDGNL
DNTDADYTGKYAASTCYNSEKATDLGGMMRNERDWVVVFNIPRIEAAIKAGKFTTLGDSK
VPVVDGRHGSDLTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTIIEIARLDDLFGGKL
KKPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVAKWNIEEAIRAYQGEKTNYIKQ
KLDVHYQPGHNHASLTESRDADGKWLVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMKL
VHDGPTFAEPHDCILVRRDQIKTKKIWERNDPFFAATVARAKKDGITLEQDNKVIREGNK
VRVYMTSMAPAYGLAEFKVKQGDEVTVTITNIDRIEDVSHGFVLTNHGVSMEISPQQTSS
ITFIADKPGVHWYYCSWFCHALHMEMVGRMLVEKA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgatcagttcaacgacgacaacgggaatgctcagggcgagggactgacccgg
cgcggattcctcggcgccggcactctcgggggcgcggccctggcgggcgccgccactctg
ggtggcgtggtgatgacgcgggaaacctgggcctcctcggtaaaggaagccatggccaag
gcccatgtggggcccggtgagctggatgaatattacggcttctggagtggtggacactcc
ggcgaggtgcgggtgctgggtgtgccctccatgcgtgaactgctgcggattccggtgttc
aacgtggattccgccacgggttgggggctgaccgacgaaagcaaacaggtgcttggtgac
agcgcccgttacctcaacggtgacagccaccacccgcacatctccatgacggatggccgg
tatgacggcaaatacctgttcatcaatgacaaggccaacagccgggtggcccgggtgcgt
ctggatatcatgaaatgcgaccgcatcctcacggtacccaacgtccaggccatccacggt
ctgcgcctgcagaaagtgccgcacaccaagtatgtgttcgccaacgcggaattcatcatt
ccgcatcccaatgacggctcgtccttcgatatccaggatgatggcagctacacgatgttc
aacgccatcgacgccgagcggatggagatggcgttccaggtcatcgtcgacggtaacctg
gacaacaccgacgccgactataccggcaagtacgcggcgtccacctgttacaactcggag
aaagccacggacctgggcggcatgatgcgcaatgagcgcgactgggtggtggtgttcaat
atcccgcgcatcgaagcggccatcaaagccggcaagttcaccacgctgggtgacagcaag
gtgccggtggtggatggccggcacgggtcggatctgacccgctacattccggtgccgaag
aacccgcacggcctgaatacatcgccggacggcaagtacttcatcgccaacggcaagctc
tcgcccacctgcaccatcattgagatcgcgcggctggacgacttgttcggcggcaagctc
aagaaacccagggatgtggtggtgggcgaaccggagctggggctggggccgctgcacacc
accttcgatggtcgtggcaacgcctataccactctgttcatcgacagccaggtggcgaag
tggaacatcgaagaggcgatccgcgcttaccaaggggaaaaaaccaactacatcaaacag
aagctggatgtgcactatcagccagggcataaccacgcctcgctgaccgaaagtcgggac
gcggatggcaagtggctggtggtgctgagcaagttctccaaggaccgtttcctgcctacc
ggtccactgcacccggagaatgatcaactgatcgatatttccggcgaggaaatgaaactg
gtgcatgacggccccacctttgccgaaccccacgactgcatcctggtgcgccgggatcag
atcaagacgaaaaaaatctgggagcggaacgatccgtttttcgccgccaccgtggcccgg
gcgaaaaaagacggcatcaccctggagcaggacaacaaggtgatccgtgagggtaacaag
gtgcgggtctatatgacctccatggcaccggcttacggattggccgagttcaaggtgaag
cagggcgacgaagtcacggtgaccatcaccaacatcgatcgtatcgaggacgtgtctcac
ggtttcgtgctcaccaaccacggtgtcagcatggaaatcagtccgcagcaaacctcttcc
atcaccttcatcgccgataaacccggcgtgcactggtattactgcagctggttctgtcat
gccctgcacatggagatggtcggccgcatgctggtggagaaagcctga

DBGET integrated database retrieval system