KEGG   Alcanivorax dieselolei: B5T_04395Help
Entry
B5T_04395         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
adi  Alcanivorax dieselolei
Brite
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     B5T_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-ProteinID: AFT72654
UniProt: K0CGJ3
Position
complement(4865201..4865638)
Genome map
AA seq 145 aa AA seqDB search
MSEPFRYRLRVRYSECDAQHVVFNARYGDYVDLAMTEFMRALGRDYDALLARGLDNQVVK
LTLEWKASARFDDVLEIQVKPLSLGNTSFSLEFLILNAESQQLLCRAESVYVMMTTEPFE
KTRVPDDLRAALQEGAVGKVCDQSG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctttccgttaccggctgcgcgtgcgttacagtgaatgcgatgcccagcat
gtggtgttcaacgcccgttacggtgactatgttgacctggccatgaccgagttcatgcgt
gctttggggcgggattacgatgccctgctggcgcgtgggctggataaccaggtagtgaag
ctcactctggaatggaaagcttccgcacgttttgatgatgtactcgagattcaggtcaaa
ccgctgtcgttgggtaacacctcgttctcgttggaattccttattctgaacgcggaaagt
cagcagctgctgtgccgggcggaatcggtgtacgtgatgatgaccactgaaccgttcgag
aaaacccgggtgcccgatgatctgcgggccgcgttgcaggaaggcgccgtcggtaaggtg
tgcgaccagagcggttga

DBGET integrated database retrieval system