KEGG   Alcanivorax dieselolei: B5T_04415Help
Entry
B5T_04415         CDS       T02259                                 

Definition
(GenBank) Transcriptional regulator, MarR family
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 TrmB GntR HTH_Crp_2 HTH_24 TFIIE_alpha Penicillinase_R DUF2250 Cdc6_C HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AFT72674
UniProt: K0CGM5
Position
4886462..4886947
Genome map
AA seq 161 aa AA seqDB search
MATAIERSALLGRPGFLIRRLHQIHCGLFLDETREHNITPVQYSLMTTLSTHGEMDQNSL
AHEIGLERTSVAEVIPRLEARGLLKRRQSDEDRRFKLVKLSRKGVYLLKKMEAAVQRAHD
RTIEAIPKDQRDVFMLQLIRLVEANNENGSAPFRLNKDGDG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccgcgatcgaacgttccgccctgcttggccgtccgggtttcctgattcgccgt
ttgcaccagatccactgcgggctgttcctggacgaaacccgggagcacaacatcaccccg
gttcaatacagcctgatgaccacgttaagcactcatggagagatggatcagaatagcttg
gcccacgaaatcggcctggagcgcaccagtgtggcggaggtgattccccgtttggaagcc
cgaggcttgcttaaacgccgacagagcgacgaagaccgccgcttcaagctggtaaagcta
agccgtaaaggggtttatttgctgaagaagatggaggccgccgtacaacgggcccacgat
cgtactatcgaggcgatcccgaaagatcagcgtgatgtcttcatgttgcagttgatcaga
ctggtggaagccaacaacgaaaatggcagcgcgcccttccgattgaacaaggacggcgac
ggataa

DBGET integrated database retrieval system