KEGG   Alcanivorax dieselolei: B5T_04418Help
Entry
B5T_04418         CDS       T02259                                 

Gene name
atpG
Definition
(GenBank) ATP synthase gamma chain
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
adi  Alcanivorax dieselolei
Pathway
adi00190  Oxidative phosphorylation
adi01100  Metabolic pathways
Module
adi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    B5T_04418 (atpG)
Photosynthesis proteins [BR:adi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   B5T_04418 (atpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt
Motif
Other DBs
NCBI-ProteinID: AFT72677
UniProt: K0CLM4
Position
complement(4892324..4893184)
Genome map
AA seq 286 aa AA seqDB search
MASGKEIKGKISSVQSTKKITRAMEMVAASKMRKAQDRMAASKPYATRIRQVVAHLANAD
LEYRHSYLQEREVKSVGYIVVTSDRGLCGGLNVNLLKNVVQGAREWQEQGAKVSYCLVGS
KGISFFKSMGGDVQATVNGLGDTPHLDDLVGSIKVMLEAYESGEIDRLYIVYNEFVNTMT
QQAKQIQLLPLEQGEDEELKRHWDYIYEPAPKELLDELLVRFIESQVYQGVVENNACEQA
ARMVAMKAASDNAGDIIRDLQLVYNKARQAAITQEISEIVGGAAAV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctagcggtaaagagatcaaaggcaagatctctagcgtccagagcacgaagaagatc
acccgtgcgatggagatggtggcggccagcaaaatgcgcaaggcgcaggaccgcatggct
gccagcaagccctacgccacccgcattcgtcaggtggtggcgcatcttgccaacgctgat
ctggaataccggcactcctacctgcaagagcgggaagtgaagagcgtgggctacatcgtg
gtgacttccgatcggggtctgtgcggtggcctgaacgtgaacctgctcaagaatgtggtg
cagggcgctcgtgaatggcaggagcagggtgccaaggtaagctattgcctggtgggttcc
aagggcatcagtttcttcaagagcatgggcggtgacgtgcaagccaccgtcaacggtctt
ggcgatacgccgcacctggacgacctggtgggctccatcaaggtcatgctggaggcctat
gagtcaggtgagatcgaccgtctgtacattgtgtacaacgaattcgtgaacaccatgacg
cagcaggccaagcagatccagttgctgccgctggagcagggcgaggatgaagagctcaaa
cgccattgggactacatctacgagccggcgcccaaggagctgcttgatgagctgctggtg
cggttcatcgagtcccaggtataccagggtgtggtagagaacaatgcctgcgaacaggcg
gcgcggatggtggcgatgaaggcggccagtgataacgccggtgacatcattcgtgatctg
caactggtgtacaacaaggcgcgccaggcagccattacgcaggaaatttccgaaatcgtt
ggtggtgccgccgcggtctga

DBGET integrated database retrieval system