KEGG   Alcanivorax dieselolei: B5T_04435Help
Entry
B5T_04435         CDS       T02259                                 

Gene name
cspG
Definition
(GenBank) Bifunctional GMP synthase/glutamine amidotransferase protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
adi  Alcanivorax dieselolei
Brite
Transcription factors [BR:adi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    B5T_04435 (cspG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AFT72694
UniProt: K0CGP7
Position
4911950..4912153
Genome map
AA seq 67 aa AA seqDB search
MATGTVKWFNESKGFGFISQDDGGADVFVHFSAIQGSGFRTLAEGQKVSFDIQQGPKGPQ
AANVEAG
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggctactggtaccgttaaatggttcaacgagtccaaggggttcggtttcatctcccag
gacgacggtggtgcggacgtattcgttcacttcagcgcgatccaaggctccgggttccgt
accctggctgaaggtcaaaaagtttccttcgatatccagcagggcccgaaaggcccgcag
gcagctaacgtagaagccggctaa

DBGET integrated database retrieval system