KEGG   Alcanivorax dieselolei: B5T_04443Help
Entry
B5T_04443         CDS       T02259                                 

Gene name
fumC
Definition
(GenBank) Lyase superfamily
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00020  Citrate cycle (TCA cycle)
adi00620  Pyruvate metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
Module
adi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5T_04443 (fumC)
   00620 Pyruvate metabolism
    B5T_04443 (fumC)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     B5T_04443 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-ProteinID: AFT72701
UniProt: K0CM38
Position
complement(4920836..4922218)
Genome map
AA seq 460 aa AA seqDB search
MSDVRIEKDSLGEVQVPKAAFWGAQTQRAVDNFPISGRRLPPRFIQAVARIKRCAASVNV
DLELLSEERGDAIRSVCEALINGEHRDQFPVDVFQTGSGTSTNMNVNEVVAHLCQTQGVD
VHPNDHVNLGQSSNDTIPTAIHVSSAMAVNEQLMPALELLITTLGSKAGEGKDLVKTGRT
HLMDAMPVTVEQELRTWVLQLQAASQRLAVARDELHAVPQGGTAVGTGINAHAEFAERFV
DALSDETGHPFTAMPYPAVAQSAVDAPLALSSALRGLAVVLMKISNDLRWMNSGPIHGLA
EIQLPATQPGSSIMPGKVNPVICESATMVAAQVIGLDQANTVAAQSGNFQLNVMLPLVAA
NLLDMVEWLANSCRNLADQAISGLTYNREHLAEGVGRNPILVTALNPVIGYEKAAAIAKQ
AFASGRPVIDVAAEQTDLSVEQLTALLDPLKLTHPAASDS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtacggattgaaaaggattccttgggcgaagtgcaggttccgaaggctgcg
ttttggggcgcgcagacccagagagcggtggacaactttccgatcagtgggcgccggtta
ccgcctcggttcattcaggcggtggcccggatcaagcgttgcgcggcctcggtgaacgtg
gatctggagctgctgtccgaggaacggggtgacgctatccgttcggtctgcgaagcgctg
atcaacggtgagcatcgggatcagttcccggtggacgtgttccagaccggttccggtacc
agcaccaacatgaacgtcaacgaggtagtggcccatctgtgccagactcagggcgtggac
gtgcatcccaacgatcacgtcaatctcggccagagcagtaacgacaccattcccaccgcc
attcatgtgtcctcggcgatggccgttaacgaacagttgatgcccgcccttgagcttttg
atcaccacgctgggatcgaaggccggggaaggcaaggatctggtcaaaaccggccgcacc
cacctgatggacgccatgccggtgacggtggagcaggagttgcgcacctgggtgctgcaa
ctgcaggccgccagccagcgtctggcggttgcccgggatgagctgcatgccgtgccacag
ggcggtaccgcggtggggaccggtatcaacgcccatgccgagttcgccgagcgcttcgtc
gatgcgctgtccgatgaaaccgggcatccgtttaccgccatgccgtacccggccgtggcg
cagagcgccgtggatgcccccctggcactgtcgtcggcgttgcgtggtctggcggtggtg
ttgatgaaaatcagcaatgacctgcgctggatgaactccggtccgattcatggtctggcg
gaaattcaactgccggccacacagccgggttcgtcgatcatgccggggaaggtcaatccg
gtgatctgcgagtccgccaccatggtcgccgcccaggtgatcggtctggatcaggccaat
acagtggcggcgcagagcggtaactttcagctcaacgtcatgttgccgctggtggccgcc
aaccttctggatatggtggagtggctggccaacagttgccggaatctggcggaccaggcc
atctccgggctgacttacaaccgtgagcatctggccgagggtgtgggccgcaatccgatc
ctggtcaccgctctgaacccggtgatcggctatgagaaggcggcggccatcgccaaacag
gcgttcgccagcggccggccggtgatcgatgtggcggcggagcaaaccgacctgtcggtg
gagcaactcaccgctttgctcgacccgctcaaactgacacatccggcggcctctgactct
tga

DBGET integrated database retrieval system