KEGG   Alcanivorax dieselolei: B5T_04447Help
Entry
B5T_04447         CDS       T02259                                 

Gene name
yidC
Definition
(GenBank) Membrane protein oxaA
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
adi  Alcanivorax dieselolei
Pathway
adi02024  Quorum sensing
adi03060  Protein export
adi03070  Bacterial secretion system
Module
adi_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:adi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    B5T_04447 (yidC)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    B5T_04447 (yidC)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    B5T_04447 (yidC)
Mitochondrial biogenesis [BR:adi03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    B5T_04447 (yidC)
Secretion system [BR:adi02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   B5T_04447 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YidC_periplas 60KD_IMP P2X_receptor
Motif
Other DBs
NCBI-ProteinID: AFT72705
UniProt: K0CK35
Position
complement(4925517..4927202)
Genome map
AA seq 561 aa AA seqDB search
MIQAWQRDYAAPDTVEPQISEQVAGNNTDANANTTGNDLVPDPQEHTDPTASSIPGGEVS
DSIPDNKAQSGGAIHVATDVLNLEIDPRGGDIVRLSLPAYPRHADTPDQPFVLLENTSSR
TYVAQTGLIGTNGTDSASGRPVWSSAEQSYQMGDAHELNVDLTLTQDNGARITKRYTFER
GSYLVRVTHIVENNSAETWNGQLYGQIKRDGGDDPGLSKQGFAPMPTYLGAAYWSSEKPY
NKLKFGDMEDAALSTTQEGGWIAMVQHYFLSAWIPDPQLQQTYSTVYQKNRDQYLLRFVS
QGQKVAPGETGQMYAEFYAGPKIQDHLEAISPGLNMTVDYGWLWFLSQPIFALLVFLQSG
KLSIFGLNMDIGAGVGNWGVAIILLTFVIKALFFKLSATSYRSMAKMRKVAPEMQRIREE
HKSDKQKQQMETMKLFQREKINPLGGCLPILVQMPVFIALYYVLLESVELRQAPFFLWIQ
DLSVMDPYFVLPILMGASMFLQTRLNPTPADPTQAQVMKWMPVIFSVFMLWFPAGLVLYW
LTNNLLSIGQQYIITRRIERE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcctggcagcgagactacgccgccccggacaccgtcgagccgcaaatcagc
gagcaagtggcgggcaataacaccgatgccaacgccaataccacgggtaacgacctggtg
cccgatccgcaggagcataccgacccgacggcatcctccatccccggcggagaagtgagc
gacagcattccggacaacaaagcgcaaagcggcggggccattcatgtcgccaccgatgtg
ctgaacctggaaatcgatccccgtggcggcgacatcgtgcgcttgagcctgccggcttat
ccgcgccatgccgacaccccggaccagccttttgtactgctggaaaacacctcttcccgc
acttacgtggctcagacgggtctgatcggcaccaatggcaccgattccgcttccgggcgc
ccggtgtggagcagtgccgagcagagttaccagatgggcgatgcccatgaactgaatgtg
gatctgacgctgacccaggacaacggcgccaggatcaccaagcgctacacgttcgagcgc
ggcagttacctggtgcgggtgacccacattgtcgagaacaacagcgcagaaacctggaac
ggtcagctctacggccagatcaaacgggacggtggtgacgatccgggcttgtccaagcag
ggcttcgcgcccatgcccacctatctgggcgccgcctactggtccagcgagaagccgtat
aacaagttgaaattcggcgatatggaagacgccgccttgagcaccacgcaggaaggtggc
tggatcgccatggttcagcattatttcctgtccgcctggattcctgacccgcagttgcag
cagacctattccacggtgtatcagaagaaccgtgatcagtacctgctgcgattcgtgtcc
cagggccagaaagtggcgcccggcgaaaccgggcagatgtacgccgagttctatgccggc
ccgaaaatccaggatcacctggaagccatcagccccgggttgaacatgaccgtggactac
ggctggttgtggttcctgtcccagccgatctttgctctgctggtgttcctgcaaagtggc
aagctctccatcttcggtctgaatatggatattggcgccggtgtgggcaactggggtgtg
gcgattatcctgctgaccttcgtcatcaaggcgctgttcttcaaactcagtgccaccagc
taccgctccatggccaagatgcggaaggtcgcaccggagatgcagcgcattcgtgaagag
cacaagagcgacaagcagaaacagcaaatggagaccatgaagctgttccagcgggaaaag
atcaatccgctcggcggctgcttgccgattctggtgcagatgccggtgttcatcgccctg
tactatgtgctgctggaatccgtggagttgcgtcaggcgccgttcttcctgtggatccag
gatttgtcggtcatggacccgtacttcgtcttaccgattctgatgggcgcgtccatgttc
ctgcagacccgtctgaatccgacgccggcggatcccacccaggctcaggtaatgaaatgg
atgccggtgatcttctcggtcttcatgctgtggttcccggcgggtctggtactctactgg
ctgaccaacaacctgttgtccatcggccagcaatacatcattacccgccgaatcgagcgg
gagtga

DBGET integrated database retrieval system