KEGG   Alicycliphilus denitrificans K601: Alide2_0039Help
Entry
Alide2_0039       CDS       T01463                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Alide2_0039
Enzymes [BR:adk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Alide2_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46719..48596)
Genome map
AA seq 625 aa AA seqDB search
MNFLLRSAAALLCSLFVGGAATAKPQVATLIVMPQDLRQNPQIVSDLQRRGINHATVYLT
WADVEAQPGHFDFSAYDPYFDQLTQGGLSLVVVLDMGGRAYFDGTGKHFPGRTTVPEWLY
RQVPDGFMKNFSGQSTPQPDFMNPTVRQFSAQFVRNAVAHLSQRYPGKVTAYSIGLQEEH
EIKYGQTGYQWRDYADAAQAAFRQQTGAPLPVINYTSDIALGLPRTEPLLHAHKQFREAN
LKEATCFYADAIRSQGGRAMSYFGELFTAHDGIYATSVAEQLADCLDIAVIDYNFYDGYS
LSPDARVLPMLANYMASVGYKQIMVGAYAEQWERVKKSTELLPVISRTLSTALAQPNVIG
YEVGGLQRQLDTHLTGTVDLDKLQALRVQPPVPATASTGKKLTVGILASTSNYYVWHGDR
SGGVNVHREALLEAYNLLSTQPGFDVHVIGEKNLQEDDLLQRLNAIVVPHQAALPASIKQ
QLKAYWKKGGTLVQDMRLGEFDENGKPVYDWMHEVFGIENITWRPRGGIFLTDDGQILRL
KPARKLYTGYAAMTPRPGYRLLATDILNKRQGIMVRGERTLVFGFTPQLVEDATQAMWQQ
IFVREIANAVRCPTLATCKTPPRSP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccttctccgctcagccgcagcactgctgtgctctctgtttgtcggcggtgct
gcaactgccaagccgcaggtggccaccctcatcgtcatgccccaggatctgcgtcagaac
ccgcagatcgtcagcgacctacagcgccgaggcatcaaccacgccacggtgtaccttacc
tgggccgacgtcgaagcacagccgggccatttcgacttctcggcctacgacccgtacttc
gaccagctcacccagggtggactatcgcttgtcgtcgtgctcgacatggggggccgcgcg
tacttcgatggaacgggcaagcatttccccggccgcaccaccgtgcctgaatggctgtac
aggcaggtgcccgatgggtttatgaagaacttctcgggccagtccacgccgcagcccgac
ttcatgaaccccacggtgcgccagttctcggcccagttcgtgcgcaatgccgtggcccat
ctctcgcagcgctatcccgggaaggtcacggcctactccatcggcctgcaagaagagcat
gaaatcaaatacggccagaccggctaccagtggcgcgactacgccgacgccgcgcaggct
gccttccgccagcaaacgggcgcaccgctgcccgtcatcaactacaccagcgacattgcc
ctgggcctgcccaggacggagccgctgctgcacgcgcacaagcagttccgcgaagcgaat
ctgaaggaggccacctgcttctacgccgacgccatccgcagccagggcggccgcgccatg
agctactttggcgaactcttcaccgcgcacgacggcatctacgccaccagcgtggccgag
caactggccgactgcctggacattgccgtcatcgactacaacttctacgacgggtacagc
ttgtcgcccgacgcgcgcgtgctgcccatgctggccaactacatggcctcggtgggctac
aagcagatcatggtgggcgcctatgccgagcagtgggagcgcgtgaaaaaatccaccgaa
ctcctgcccgtcatcagccgcaccctgtccaccgcgctggcgcagccgaacgtgatcggc
tacgaggtgggcggtctgcagcgccaactcgacacgcacctcaccggcacggtggatctc
gataagctccaggccctgcgcgtgcagccccccgtgcccgccactgccagcacgggaaag
aaactcaccgtgggcatcctcgcctccaccagcaactactacgtatggcacggggaccgc
agcggcggcgtcaacgtgcaccgcgaggcgctgctcgaagcctacaacctcctgagcacg
cagccgggcttcgacgtccacgtcatcggtgaaaagaacctgcaggaagacgatctgctg
cagcgcctgaacgccatcgtagttccacaccaagccgccctgcccgcatccatcaagcag
cagctcaaggcctactggaaaaagggcggcacgctggtccaggacatgcgccttggcgaa
ttcgatgagaacggcaaacccgtctacgactggatgcacgaggttttcggcatcgagaac
attacgtggaggccgcgcggcggcatcttcctgacggacgacggccagatcctgcgcctg
aaacctgcgcgcaagctgtacacgggctacgcggccatgaccccgcgtcctggctatcgc
ctgctggccaccgacatcctcaacaagcgccaaggcatcatggtgcgtggcgaacggacg
ctggtgttcggctttacgccgcaattggtcgaagatgccacccaggccatgtggcagcag
attttcgtgcgcgaaatcgccaacgccgtgcgatgccccacactcgctacttgtaaaacg
cctccacgctccccttga

DBGET integrated database retrieval system