KEGG   Alicycliphilus denitrificans K601: Alide2_0238Help
Entry
Alide2_0238       CDS       T01463                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Alide2_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
270901..271920
Genome map
AA seq 339 aa AA seqDB search
MKQKSSPVRHAARFMLGAVSMAALLMAAPVRAQEPVQPIAGPKVTSPAKVELGKKLWFDP
RLSRSGFISCNSCHNLSMGGSDNLKTSIGDKWQKGPINSPTVLNSSLNLAQFWDGRAKDL
KEQAGGPIANPGEMAFTHGLAVDMLRSIPQYVAEFKKVFGHDKLTIDEVTAAIAAFEETL
VTPNARFDKWLKGDKKAINAQELRGYQLFKSSGCVACHNGPNLGGNSFQKMGLVEPYKTD
NPAEGRSAVTGNDAERFNFKVPTLRNVELTYPYFHDGAADTLSQAVDTMGRLQLGKKFTG
QENADIVAFLKTLTGDQPKIAMPILPPSSDKTKRPQPFE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaagtcctctcccgtgcgccatgccgctcgcttcatgctgggcgcggtgtcc
atggcagccctgctgatggctgctcccgtgcgcgcgcaggaacccgtgcagccaatcgcc
ggccccaaggtgaccagccccgccaaggtcgagttgggcaagaagctgtggttcgacccg
cgcctgtcgcgctcgggcttcatctcgtgcaactcgtgccacaacctgagcatgggtggc
tcggacaacctcaagacctccatcggcgacaagtggcagaagggcccgatcaactcgccc
acggtgctcaactccagcctgaacctcgcccagttctgggatggccgcgccaaggatctg
aaggagcaggccggcggtcccatcgccaacccgggcgagatggccttcacgcacggcctg
gccgtggacatgctgcgctccatcccgcagtacgtggccgagttcaagaaggtcttcggc
catgacaagctcaccattgacgaggtgacggccgccatcgccgccttcgaggaaacgctg
gtcacccccaacgcgcgcttcgacaagtggctcaagggcgacaagaaggccatcaatgcg
caggaactgcgcggctaccagctcttcaagagctccggctgcgtggcctgccacaacggc
cccaacctgggcggcaactcgttccagaagatgggcctggtcgagccctacaagacggac
aacccggccgagggccgctccgccgtcacgggcaacgacgccgagcgcttcaacttcaag
gtgccgacgctgcgcaacgtggaactgacgtacccctacttccacgacggcgccgccgac
acgctgtcccaggccgtggacaccatgggccgcctgcaactgggcaagaagttcaccggg
caggagaacgccgacatcgtcgccttcctgaagacgctgacgggcgaccagcccaagatc
gccatgcccatcctgccgccgtcgagcgacaagaccaagcggccccagccgttcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system