KEGG   Alicycliphilus denitrificans K601: Alide2_0283Help
Entry
Alide2_0283       CDS       T01463                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adk00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:adk00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:adk00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:adk00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:adk00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312466..313380
Genome map
AA seq 304 aa AA seqDB search
MNQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLKRAREMGIKTTHEGVD
GLVPHMKQDGVQIVFDATSAYVHAENSRKVNAQGALMIDLTPAAIGPYCVPPVNLKEHLG
RGETNVNMVTCGGQATIPMVVAVSRVQPVAYGEIVATVSSRSAGPGTRKNIDEFTRTTAG
AIEKVGGAKKGKAIIVINPADPPLIMRDTVHCLTEEEPDREAITQSIHAMLAEVQKYVPG
YKLVNGPVFDGKRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEMLAGRLAFQ
PVAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaaaatcaaatgcgccctgatcgggcccggcaacatcggcaccgacctgctc
gccaagctgcagcgcagcccggtgctggaacccgtgtggatggtgggcatagaccccgag
tccgacggcctcaagcgcgcgcgcgagatgggcatcaagaccacgcacgagggcgtggac
ggcctggtgccgcacatgaagcaggacggcgtgcagatcgtcttcgacgccaccagcgcc
tacgtgcacgccgagaactcgcgcaaggtgaatgcgcagggcgcgctcatgatcgacctc
acgcccgccgccatcggcccgtactgcgtgccgcccgtgaacctgaaggagcacctgggc
cgcggcgagaccaacgtcaacatggtcacctgcggcggccaggccaccatccccatggtg
gtggcggtaagccgcgtgcagcccgtggcctacggcgagatcgtggccaccgtctccagc
cgctccgccggcccgggcacgcgcaagaacatcgacgagttcacgcgcaccaccgccggc
gccatcgagaaggtgggcggcgcgaagaaaggcaaggccatcatcgtcatcaacccggcc
gacccgccgctcatcatgcgcgacaccgtgcactgcctgaccgaggaggagccggaccgc
gaggccatcacgcaaagcatccacgccatgctggccgaggtgcagaaatacgtgcccggc
tacaagctggtgaacggcccggtgttcgacggcaagcgcgtctcggtgttcctggaggtc
gagggcctgggcgactacctgcccaagtacgccggcaacctggacatcatgaccgccgcc
gccgcgcgcaccgccgagatgttcgccgaggaaatgctcgccggccgcctcgccttccaa
cccgtggctgcatga

DBGET integrated database retrieval system