KEGG   Alicycliphilus denitrificans K601: Alide2_0344Help
Entry
Alide2_0344       CDS       T01463                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:adk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(372369..373397)
Genome map
AA seq 342 aa AA seqDB search
MWGTITPMHLSSPTPFPANRPRRLRRDAFTRDLVRENRLTPHDFIYPVFVHEGTQLRVPV
PSMPGVERLSLDLLLPVAGECVRLGIPYLALFPSIDAQLKTPDGKEALNPEGLIPRVVRA
LKKEFPQLGVMTDVALDPYTSHGQDGMLDDTGYILNDETVEILVGQALAHAQAGVDMVAP
SDMMDGRIGAIRDALEAHGHIHTRIMAYSAKYASAFYGPFRDAVGSAANLGRSNKDVYQM
DPANTDEALREVALDLAEGADMVMVKPGMPYLDVLRRVKDEFKVPTFAYQVSGEYAMLKA
AAANGWLDHDKVMLEALLAFKRAGADGILTYFALDAARLLTK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggacaatcacgcccatgcatctgtccagccccacccccttccccgccaaccgc
ccgcgccggctgcgccgcgacgcgttcacccgcgacctggtgcgcgagaaccggctcacg
ccgcacgacttcatctaccccgtgttcgtgcacgaaggcacgcagctgcgcgtgcccgtg
ccttccatgcccggcgtggagcgcctgagcctggacctgctgctgccggtggccggggaa
tgcgtgcggctcggcattccctacctggcgctgttcccctccatcgacgcgcagctcaag
acgcccgacggcaaggaggccctgaaccccgagggcctgatcccgcgcgtggtgcgcgcg
ctgaagaaggagttcccgcagctcggcgtgatgaccgacgtggcgctggacccctacacc
agccacggccaggacggcatgctcgacgacaccggctacatcctgaacgacgagacggtc
gagatcctcgtgggccaggcgcttgcccacgcccaggccggcgtggacatggtggcgccc
agcgacatgatggacgggcgcatcggcgcgatccgcgacgcgctggaggcccacggccac
atccacacgcgcatcatggcctacagcgccaagtacgccagcgccttctacgggccgttc
cgcgacgccgtgggctcggccgccaacctggggcgcagcaacaaggacgtctaccagatg
gacccggccaacaccgacgaggcgctgcgcgaggtggcgctggatctggccgagggcgcc
gacatggtcatggtcaagcccggcatgccgtacctggacgtgctgcgccgcgtgaaggac
gagttcaaggtgcccaccttcgcctaccaggtcagcggcgagtacgccatgctcaaggcc
gccgcggccaacggctggctggaccacgacaaggtgatgttggaggcgctgctggccttc
aagcgcgccggcgctgacggcatcctgacctacttcgccctggacgccgcacggctgctc
acgaaataa

DBGET integrated database retrieval system