KEGG   Alicycliphilus denitrificans K601: Alide2_0563Help
Entry
Alide2_0563       CDS       T01463                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide2_0563
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_0563
   00052 Galactose metabolism
    Alide2_0563
   00500 Starch and sucrose metabolism
    Alide2_0563
   00520 Amino sugar and nucleotide sugar metabolism
    Alide2_0563
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Alide2_0563
   00524 Butirosin and neomycin biosynthesis
    Alide2_0563
Enzymes [BR:adk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Alide2_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585960..586919
Genome map
AA seq 319 aa AA seqDB search
MLAGVDLGGTKVAVCLAMPSGAGEPPALLARLSEPTVKTGEADALARQVLRLLDAACAAQ
GLTRGDVAAVGVASCGPFVRRAGRVEVSNPNICGGLAGAPRGLGNGWTCVPLEAPLARAM
GEGRVQVANDAVAALAAERRWGALRGVDDCAYVTWSTGIGVGLCVDGRVLRGKNGNAGHA
GHSFVGDVAGEPPLCGCGNRGDVESLVAGNALPRRLGLQAQALLDAAARGDAAALAQVRG
LCALMGRLFYNLVATLDLRRISIGGAVFLHHEALLLPLLRAELVRHFAVLTDGVELVRAG
LGERVGDYAALALLDSSSA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggcgtggacctcggcggcaccaaggtggccgtgtgcctggccatgccgtcc
ggcgccggcgagccgcccgcgctgctcgcgcgcctgagcgagcccaccgtcaagaccggc
gaggccgatgcgctcgcgcggcaggtgctgcgcctgctggacgcggcctgcgccgcgcag
ggcctgacgcgcggcgacgtggcggccgtgggcgtcgcatcgtgcgggccgttcgtgcgc
cgcgcgggccgggtggaggtgagcaaccccaacatctgcggcggcctcgcgggcgcgccg
cggggcctgggcaatggctggacttgcgtgccgctggaggcgccgctggcgcgggcgatg
ggcgaggggcgcgtgcaggtggccaacgacgcggtggccgcgctggccgccgagcgccgc
tggggtgcgctgcgcggcgtggatgactgcgcctacgtgacctggagcaccggcatcggc
gtgggcctgtgcgtggacgggcgcgtactgcgcggcaagaacggcaacgcggggcatgcg
ggccattccttcgtcggcgatgtggcgggcgagcccccgctgtgcggctgcggcaaccgg
ggcgatgtggagtcgctcgtcgcgggcaatgccctgccgcgccggctggggctgcaggcg
caggccctgctggacgccgccgcgcgcggcgacgcggcggcgctcgcgcaggtgcgcggg
ctgtgcgcgctcatggggcggctgttctacaacctggtggccacgctggacctgcggcgc
atcagcatcggcggcgcggtgttcctgcaccacgaggcgctgctgctgccgctgttgcgc
gcggagctggtgcgccacttcgcggtgctgaccgatggggtggaactggtgcgcgcgggt
ctgggcgagcgggtgggcgactacgcggcgctggcgctgctcgactcctccagcgcctga

DBGET integrated database retrieval system