KEGG   Alicycliphilus denitrificans K601: Alide2_0698Help
Entry
Alide2_0698       CDS       T01463                                 

Definition
exosortase 1 system-associated amidotransferase 1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alide2_0698
Enzymes [BR:adk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Alide2_0698
Peptidases [BR:adk01002]
 Cysteine Peptidases
  Family C44
   Alide2_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723062..724972
Genome map
AA seq 636 aa AA seqDB search
MCGISGIFDTRGTGTIPRDLISRINNVQSHRGPDENEVHLEPGLALGHRRLSVIDLATGT
QPLFNEDGTVGIVFNGEIYNYLELMQELNDLGYRFRTRSDTEVIVHAWQAWGEACVHRLR
GMFAFALWDRKHQTLFLARDRMGVKPMHYAWLPDGSFIFGSELKVLTAHPGFVRDIDPLA
VEGYFSFGYVPDPRCIYQNAHKLPAAHTLTLRRGDAGRPAPRPYWDVRFTNDNPIKLQDA
QAELRERVRESVRLRMIADVPLGAFLSGGVDSSAVVATMAGLSSTPVHTCSIGFDDPRFD
ESSFAQQVADHYRTDHRLDIVSSDDFDLIDTLAWLYDEPFADSSAIPTYRVCQMARKHVT
VALSGDGGDESMGGYRRYRMHLGEEAVRGRLPLALRRGMFGPLGRWYPKADWAPRSLRAK
TTFQALAMDSVQAYCHSMSQLRGDERRALFSPAFQRSLGGYGALEVFRLHAEQAQTEDPL
ALIQYLDYKTWLVGDINTKVDRASMAHSLEVREPLMDHLLVEWLATLPSDFKIRAGQGKV
IFKQAYEPLLPRDVLYRPKMGFSVPLAAWLRGPLKDRVRLALLGERMRDCGYFNPVTLRR
LVDEHNSGLRDHATALWMLLMFEAFLRLNEGAAPHG
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttccggcattttcgacacgcggggtacgggcacgatcccgcgcgacctg
atttcgcggatcaacaacgtccaatcccaccgcggacccgacgaaaacgaagtccacctg
gagcccggcctggcattggggcaccggcgcctgtcggtcatcgacctagccacgggcact
cagcctctgttcaatgaagacggcaccgtgggcatcgtcttcaatggcgagatctataac
taccttgagttgatgcaggagctcaatgatctgggctaccgtttcaggacgcgcagcgac
actgaagtgatcgtgcatgcctggcaggcctggggtgaggcgtgcgtgcacaggctcaga
ggcatgttcgccttcgccttgtgggatcgtaaacaccaaaccttgtttcttgcacgcgac
cgcatgggcgtcaagcccatgcattacgcgtggttgccggacggcagcttcatttttggc
tccgagctcaaagtgctgaccgcccacccgggtttcgtgcgcgacatcgatccgctcgcg
gtggagggctatttttcgttcgggtacgttcccgatccgcgctgcatctaccagaacgcc
cacaagctgcccgctgcccacacgctcacgctgcgccgtggtgacgcaggcaggccggct
ccacgcccctactgggacgtgcgcttcaccaacgacaaccccatcaagctgcaggacgcg
caagccgagctgcgtgagcgcgtgcgcgagtccgtgcgcctgcgcatgatcgccgatgtg
ccactgggcgccttcctgtcgggtggcgtggattccagtgccgtggtggccaccatggcg
ggcctgtccagcacgccggtgcacacctgctccatcgggtttgacgatcctcgtttcgat
gagtcgagcttcgcccagcaggtggccgatcattaccggaccgaccataggctggatatc
gtcagcagcgacgacttcgatctcatcgacaccttggcctggctctacgacgagcccttt
gcggacagttcggccattcccacgtatcgcgtctgccagatggcgcgcaagcacgtcacg
gtggcgctctccggtgacgggggcgacgagagcatgggcggttaccggcgctaccgcatg
catctcggcgaggaggccgtacgcgggcgcctgccgctcgcgctgcgccgcggcatgttc
ggaccattggggcgctggtatcccaaggccgactgggcgccgcgttcgctgcgcgccaag
accaccttccaggccctggccatggatagcgtgcaggcatactgccacagcatgtcgcaa
ctgcgtggcgacgagcgccgggcgctgttctcgcctgccttccagcgcagtttggggggc
tatggcgcgctcgaggtgtttcgcctgcatgccgagcaggcccagaccgaggacccgctt
gccctgatccagtacctggactacaagacttggttggtgggcgacatcaacaccaaggtc
gatcgcgccagcatggcccactcgctggaggtgcgcgagccgctgatggatcacctgctg
gtggagtggctggccacgctgcccagcgacttcaagatccgcgcaggccagggcaaggtc
atcttcaagcaggcctatgaacccctgctgccgcgcgacgtactgtatcggccaaagatg
ggattttcagtaccgctggcggcctggttgcgcggcccgttgaaagaccgcgtgcgcctg
gcgctgctgggcgagcgcatgcgcgactgtggctacttcaaccccgtgaccctgcgccgc
ctggtcgatgagcacaacagcggcctgcgcgaccacgccactgcgctgtggatgctgctc
atgttcgaggccttcctgcgcctgaacgaaggggccgctccccatggctga

DBGET integrated database retrieval system