KEGG   Alicycliphilus denitrificans K601: Alide2_0927Help
Entry
Alide2_0927       CDS       T01463                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alide2_0927
Enzymes [BR:adk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Alide2_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
970290..971015
Genome map
AA seq 241 aa AA seqDB search
MSSEPAAEPNAPPSDEGTPVSVKIRERLAAARRRFHANDNIAEFIEPGELELLLDEVEAR
MQGVLDSMVIDTAGDHNTQSTARRVAKMYLNEVFKGRYVHPPTITEFPNAEHLNELMIVG
PITVRSACSHHFCPVIGKIWIGVLPNEHTNVIGLSKYARLVDWVMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVREMDSKMINSVMRGVFLTNSTLRREFLALIPGR
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaacccgcagcagaaccgaacgccccgccgtccgacgagggcacgcccgtt
tccgtcaagatccgcgaacggctggccgcggcgcgccggcgcttccatgccaacgacaac
atcgccgagttcatagagccgggcgagctggaactgctgctcgacgaggtcgaggccagg
atgcagggcgtgctcgacagcatggtcatcgacacggccggcgaccacaacacgcagagc
actgcgcgccgcgtggccaagatgtacctgaacgaggtcttcaagggccgctacgtgcac
ccgcccacgatcaccgagtttccgaacgccgagcacctgaacgagctcatgatcgtcggc
ccgatcaccgtgcgcagcgcctgcagccaccatttctgccccgtgatcggcaagatctgg
atcggcgtgctgcccaacgagcacaccaacgtcatcggcctgtccaagtacgcgcgcctg
gtggactgggtcatgggccggccgcagatccaggaggaggccgtggtgcagctcgccgac
ctgatcatggagaagacccagcccgacggcctggccatcgtcatggaggccagccacttc
tgcatgtcctggcgcggcgtgcgcgagatggacagcaagatgatcaactccgtgatgcgc
ggcgtgttcctgaccaactccacgctgcgccgcgaattcctggcactcatccccggaagg
aactga

  All links  
No link information was found.   
DBGET integrated database retrieval system