KEGG   Alicycliphilus denitrificans K601: Alide2_0946Help
Entry
Alide2_0946       CDS       T01463                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00900  Terpenoid backbone biosynthesis
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alide2_0946
Enzymes [BR:adk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Alide2_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEB83357
UniProt: F4G8T0
Position
complement(988779..989645)
Genome map
AA seq 288 aa AA seqDB search
MRALYDVPAPAKLNLFLHVTGRRPDGYHLLQSVFMLIDWCDTLHFELRADGAISREDLTQ
PLPADDLVVRAARALQAATGCGLGAHIGVHKRVPAQAGMGGGSSDAASTLLALNRLWGLG
LPRARLHAIGLGLGADVPFFLCGRNAWVEGIGDIIRPLDLEHQLPDASFAVVKPAAGLDT
KAIFSHPSLKRDSSCATIQGFAAMPYQFGSNDLQPVAQALCPEIDQAIDWLASKGLRGRM
TGSGSAVFAQATHAIDLHDAPAAWQVKMCENLGLHPLSDWALDERIKG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctgtacgacgtgccggcgccggccaagctgaacctgttcctgcacgtcacg
ggccgccggcccgacggctaccacctgctgcagtccgtcttcatgctgatcgactggtgc
gacaccctgcacttcgagctgcgcgccgacggcgccatcagccgcgaggacctcacgcag
cccctgcccgcagacgacctcgtggtgcgcgcggcccgcgcgctgcaagcggccaccggg
tgcggcctgggcgcgcacatcggggtgcacaagcgcgtgcccgcgcaggccggcatgggc
ggcggctcgtccgacgcggccagcacgctgctggcgctcaaccggctgtggggcctgggc
ctgccgcgcgcgcgcctgcatgccatcggcctcggcctgggcgccgacgtccccttcttt
ttgtgcggcaggaacgcctgggtcgagggaatcggtgacataatccgccctcttgatttg
gagcaccagctgccagacgcgagcttcgcggtggtcaagcccgcggcggggctggatacg
aaagccattttttcgcatccatccctcaaacgcgattccagctgtgctacaatccaaggc
tttgctgcaatgccctaccagttcggtagcaacgacctgcagccggttgctcaggccctg
tgcccggagatagaccaagccatcgactggctggcatcgaagggattgcggggtcggatg
acgggctctggaagcgcggtgtttgcgcaagcaacgcatgcaattgacctgcacgatgca
cccgctgcatggcaagtcaaaatgtgtgaaaatctagggcttcatccgctgtcggactgg
gctttggatgagaggatcaagggttga

DBGET integrated database retrieval system