KEGG   Alicycliphilus denitrificans K601: Alide2_0971Help
Entry
Alide2_0971       CDS       T01463                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Alide2_0971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_0971
  Lipid metabolism
   00071 Fatty acid degradation
    Alide2_0971
  Amino acid metabolism
   00350 Tyrosine metabolism
    Alide2_0971
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Alide2_0971
   00626 Naphthalene degradation
    Alide2_0971
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Alide2_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014693..1015760
Genome map
AA seq 355 aa AA seqDB search
MISYDVAECGQPLVRNERATPRPVGDQVLVRVEAAGVCHSDLHIWHGSYDLGNGKKMSMI
DRGMKLPLTMGHEIAGEVVAVGDAVKDVAVGKRYLVFPWHGCGECSVCRRGDENLCLAGR
SMGVFQPGGYADHVLVSHSRYLVDIGDMPPVHAAPYACSGLTTYSALKKIPAQVLKDEKL
IIFGAGGLGLMAILLARAMGSAGVIVIEPDAAKRAAALQAGALAAFDPGQDGYMAQVRQA
AGGAVWAIIDCVGSSQTVQAGIDMLTKGGQLVQIGLFGGHVDLPTPSMALRAITYQGTYV
GNLRELQELMQLVKDKRLQPVPSTCLPFGKAFTALLALEEGKAVGRQILTPEGAC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctatgacgtggccgaatgcggccagcccctggtgcgcaacgagcgcgccacc
ccccggcccgtgggcgaccaggtgctggtgcgcgtcgaggcggcgggggtgtgccactct
gacctgcacatctggcatggctcgtacgacctgggcaacggcaagaagatgtccatgatc
gatcgcggcatgaagctgcccctgaccatgggccacgagatcgccggcgaagtggtcgcc
gtgggcgatgccgtgaaggacgtggcggtgggcaagcgctacttggtcttcccctggcac
ggctgcggggaatgcagcgtgtgccggcgcggggacgagaacctgtgcctggccggccgg
tccatgggcgtgttccagccgggcggctatgccgaccatgtgctggtgtcccactcgcgc
tatctggtggacatcggcgacatgccgcccgtgcatgcggcgccctatgcgtgttcgggc
ctgaccacctacagcgccctgaagaagatacccgcccaggtgctcaaggacgagaagctc
atcatcttcggcgccggcggcctgggcctgatggccatcctgctcgcgcgggccatgggc
agcgcgggcgtgatcgtcatcgagcccgacgcggccaagcgtgccgccgccctgcaggcc
ggcgccctggcggcgttcgatcccgggcaggacggctacatggcccaggtgcgccaagcc
gcgggcggcgcggtgtgggccatcatcgactgcgtgggttccagccagaccgtgcaggcc
ggcatcgacatgctgaccaagggcgggcagctggtgcagataggcctgttcggcggccac
gtggacctgcccacgccctccatggccctgcgcgccatcacctaccagggcacctacgtg
ggcaacctgcgcgagctgcaggagctgatgcagctggtcaaggacaagcggctgcagccc
gtgcccagcacctgcctgcctttcggcaaggccttcaccgccctgctggcgctggaggag
ggcaaggccgttgggcggcagatcctgacgccggagggcgcctgctga

DBGET integrated database retrieval system