KEGG   Alicycliphilus denitrificans K601: Alide2_0997Help
Entry
Alide2_0997       CDS       T01463                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00260  Glycine, serine and threonine metabolism
adk00680  Methane metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
adk01230  Biosynthesis of amino acids
Module
adk_M00002  Glycolysis, core module involving three-carbon compounds
adk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_0997
  Energy metabolism
   00680 Methane metabolism
    Alide2_0997
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_0997
Enzymes [BR:adk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Alide2_0997
Membrane trafficking [BR:adk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Alide2_0997
Exosome [BR:adk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Alide2_0997
  Exosomal proteins of melanoma cells
   Alide2_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB83405
UniProt: F4G9J0
Position
complement(1040154..1040897)
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGIEQAKNAGRLLKAEGYEFDLAYTSVLKR
ATRTLWHCLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPTDPRCERGDIRYAGLAPEQVPLTECLKDTVARVLPYWNEAIAPTIRSGKRVLIA
AHGNSIRALVKYLDGISDQDIVGLNIPNGIPLVYELDAELKPLRSYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatccgccacggcgaatccacgtggaatctcgaaaaccgtttc
accggctggaccgacgtggatctgaccgaaaccggcatcgaacaggccaagaacgccggc
cgcctgctcaaggccgagggctacgagttcgacctggcctacaccagcgtcctgaagcgc
gccacgcgcacgctgtggcactgtctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctgaacgagcgccactacggcgcgctgcagggcctgaacaaggccgac
atggccaagcagtacggcgacgcgcaggtgctggtgtggcgccgcagctacgacacgccg
ccgccggccctggagcccaccgacccgcgctgcgagcgcggcgacatccgctacgcgggc
ctggcgcccgagcaggtgccgctgaccgagtgcctcaaggacacggtggcgcgcgtgctg
ccctactggaacgaagccatcgcgccaacgatccgctcgggcaagcgtgtgctgatcgca
gcgcacggcaactccatccgcgcgctggtcaagtacctggacggcatctccgaccaagac
atcgtggggctgaacatccccaacggcatcccgctggtgtacgagctggacgcggaactc
aagcccctgcgcagctactacctgggcgacgccgaggccgccgccaaggccgccgccgcc
gtggccgcgcagggcaaggcctga

DBGET integrated database retrieval system