KEGG   Alicycliphilus denitrificans K601: Alide2_1112Help
Entry
Alide2_1112       CDS       T01463                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Alide2_1112
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Alide2_1112
Enzymes [BR:adk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Alide2_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162261..1163688
Genome map
AA seq 475 aa AA seqDB search
MNAATTWISRSVDRLRPGADKKEKEPAAERSTHERLQASLRKSGEALSPRALRRMLADLQ
DVVAPRVSEIEGGRRAQAVADWYAGAEPAERRDMWLLMCEQFAPDATRFKSAQQRYEAAA
GTADAPQAEAHLRRALVSPRTRLLQRFAVFPDGMRFLVDLRAELLPLLKSDKRLLPLEAE
LEQLFATWFDVAFLELRRLSWDSPASLIEKLIKYEAVHDIRSWADLKNRLDSDRRCYGFF
HPRLPNEPLIFVEVALVNEISESITPLLDESAEAADIQRATTAIFYSISSTQTGLRGVSF
GDSLIKHVAETLTEEFPRLRTFATLSPIPGFRSWLAKQGAAQLERLDEKQRVELGRAVGF
MPPQIAHVLAAADKALELPPKSPVRQLLQQCAARYLGRELQDGKPLDAVARFHLGNGARV
ERLNWAADPSAKGMKQSFGMMVNYLYDLKRIDKHRALLEEGRVPVSGDIESLCGD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagccaccacctggatttcgcgcagcgtcgaccgcctgcggcccggcgccgac
aagaaggagaaggagcccgccgccgagcgctccacccacgaacgcctgcaggcctccctg
cgcaagagcggcgaggccttgtcgccgcgcgcgctgcgccgcatgctggccgacctgcag
gacgtggtggccccgcgcgtgagcgagatcgagggcggccgccgcgcccaggccgtggcc
gactggtacgccggggccgagcctgcggagcggcgcgacatgtggctgctgatgtgcgag
cagttcgcgcccgacgccacgcgcttcaagtccgcccagcagcgctacgaggccgccgcc
ggcacggccgacgcgccccaggccgaggcccacctgcgccgcgcgctggtgtcgccgcgc
acgcggctgctgcagcgcttcgccgtgttccccgatggcatgcgcttcctggtggacctg
cgcgccgagctgctgccgctgctcaagagcgacaagcggctgctgccgctggaggcggag
ctcgagcagcttttcgccacctggttcgacgtggccttcctggagctcaggcgcctgtcg
tgggactcgcccgcctcgttgatcgagaagctcatcaagtacgaggcggtgcatgacatc
cgcagctgggcggacctgaagaaccgcctggacagcgaccggcgctgctacggcttcttc
cacccccgcctgccgaacgagccgctgatcttcgtggaggtggcgctcgtcaatgagatc
tccgaaagcatcacgccgctgctggacgagtcggccgaggccgccgacatccagcgcgcg
accacggccatcttctattcgatcagcagcacccagacggggctgcgcggcgtgagcttc
ggcgactcgctcatcaagcatgtcgcggagacgctgaccgaggagttcccgcgcctgcgc
accttcgccacgctgtcgcccattccgggcttccgctcctggctggccaagcagggcgcg
gcgcagctcgagcggctcgacgaaaagcagcgggtcgagctgggccgcgccgtgggcttc
atgccgccgcagatcgcccatgtgctggccgcagccgacaaggcgctggagctgcccccg
aagtcgcccgtgcgccagctgctgcagcaatgcgcggcgcgctacctgggccgcgagctg
caggacggcaagcccctggacgccgtggcgcgctttcacctgggcaacggcgcacgcgtg
gagcggctcaactgggcggccgacccttcggccaagggcatgaagcagtccttcggcatg
atggtcaactacctgtacgacctcaagcgcatcgacaagcaccgcgcgctgctcgaggag
ggcagggtgcccgtgtcgggcgacatagaaagcctgtgcggcgattga

DBGET integrated database retrieval system