KEGG   Alicycliphilus denitrificans K601: Alide2_1178Help
Entry
Alide2_1178       CDS       T01463                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide2_1178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_1178
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Alide2_1178
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Alide2_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229393..1230823
Genome map
AA seq 476 aa AA seqDB search
MNYLSTRGDATPRKFCDILLEGLAPDGGLYLPERYPQVSDAQLTELRGAYRSQGYAELAF
RILSLYIDDIPPADLKRLCEKTYMAEVFGTREIVPLRHLEEGLWIEALSNGPTLAFKDMA
MQLLGNLFEYELARRGEQLNILGATSGDTGSAAEYAMRGKRGVRVFMTSPHGRMSPFQQA
QMFSLQDANIHNLAIEGVFDDCQDIVKAVSSDHAFKARYKIGTVNSINWARLLAQVVYYF
AGYFQATQTNAQKVSFTVPSGNFGNICAGHVARQMGLPIDRLVVATNENDVLDEFFRTGA
YRVRGAADTHETSSPSMDISKASNFERFVFDLVGRDGARTRQLFAEGVARQGFFDLGTDP
VFQDARAKYGFESGKSTHADRLATIRDTYERFGQIIDTHTADGVKVARERRGDPAVPMIV
LETALPIKFAETIQEALGRAPERPAKFEGIEQLPKRVQVLPADAERVKAYIAAHCD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctctccacccgtggcgacgccaccccccgcaagttctgcgacatcctgctc
gaaggcctggcgcccgacggcggcctgtacctgcccgagcgctatccccaggtcagcgac
gcccagctcaccgagctgcgcggggcttatcgcagccagggctatgcggaactcgccttc
cgcatcctctcgctctatatcgacgacatcccgcccgccgacctcaagcgcctgtgcgag
aagacgtacatggccgaggtcttcggcacgcgcgagatcgtgccgctgcgccacctggaa
gagggcctgtggatcgaggccctgtccaacggccccacgctggccttcaaggacatggcc
atgcagctgctgggcaacctgttcgagtacgagctggcccgccgcggcgagcagctcaac
atcctgggggccaccagcggcgacaccggcagcgcggccgagtacgctatgcgcggcaag
cggggcgtgcgcgtgttcatgaccagcccgcacgggcgcatgagccccttccagcaggcg
cagatgttcagcctgcaggacgcgaacatccacaacctcgccatcgagggcgtgttcgac
gactgccaggacatcgtcaaggcggtgagcagcgaccacgcgttcaaggccaggtacaag
atcggcaccgtcaactcgatcaactgggcgcggctgctcgcgcaggtggtctactacttc
gcgggctacttccaggccacgcagaccaacgcgcagaaggtcagcttcaccgtgcccagc
ggcaacttcggcaacatctgcgccggccatgtggcgcgccagatgggcctgcccatcgac
cgactggtcgtcgccacgaacgagaacgatgtgctcgacgagttcttccgcaccggcgcg
taccgcgtgcgcggcgcggccgacacgcacgagaccagcagccccagcatggacatcagc
aaggccagcaacttcgagcgcttcgtgttcgacctggtcggccgcgacggtgcacgcacg
cgccagctgttcgccgaaggcgtggcccggcagggcttcttcgacctggggacggacccg
gtgttccaggacgcccgagccaagtacggcttcgagagcggcaagagcacgcacgccgac
cgcctggcgacgatccgcgatacctacgagcgcttcggccagatcatcgatacccacaca
gccgacggcgtgaaagtggcgcgcgagcggcgcggcgaccccgccgtgcccatgatcgtg
ctggagacggccctgcccatcaagttcgccgaaaccatccaggaggccctgggccgcgcg
cccgagcgcccggcgaagttcgagggcatagagcagctgcccaagcgcgtgcaggtgctg
ccggccgacgccgagcgggtcaaggcctacatcgcagcccattgcgattga

DBGET integrated database retrieval system