KEGG   Alicycliphilus denitrificans K601: Alide2_1279Help
Entry
Alide2_1279       CDS       T01463                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alide2_1279
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Alide2_1279
Enzymes [BR:adk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Alide2_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339921..1341003
Genome map
AA seq 360 aa AA seqDB search
MTEHAPLIIDVAGTQLSADDRRRLAHPLVGGVILFARNWQDRAQLLALTAAIKAVRHDLL
ICVDHEGGRVQRFRTDGFTHIPPMRAFGELWMNDGKAGQGSGALRAMEAATAAGYVLGSE
LRACGVDFSFTPVLDLDWGESGVIGDRAFHRDPRVVAMLARALMQGLLQAGMANCGKHFP
GHGFVRADSHTEIPVDRRSLKAILQDDAAPYPWLSTVLTSVMPAHVIYPKVDGRPAGFSA
RWLQDILRGRLRFDGAIFSDDLSMEGARRIDGQVVGYTDAGVAALNAGCDLVLLCNQSLG
DGQAVDELIAGLADAQAAGRWQASRASEARRQALLPETLPQPWDDLMVQPAYMHALDLLP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatgcacccctcatcatcgacgtggccggcacgcagctgagcgccgacgac
cgccgccgcctggcccacccgctcgtgggcggcgtgatcctgttcgcgcgcaactggcag
gaccgcgcgcagctgctcgcgctcacggccgccatcaaggccgtgcgccacgacctgctg
atctgcgtggaccacgagggcgggcgcgtgcagcgctttcgcaccgacggcttcacccac
atcccgcccatgcgcgctttcggcgaactgtggatgaacgacggcaaggcggggcagggc
agcggcgcgctgcgcgccatggaggcggccacggcggcgggctacgtgctgggcagcgag
ctgcgcgcctgcggcgtggacttttccttcacgcccgtgctggacctggattggggcgag
agcggcgtgatcggcgaccgcgcgttccaccgcgacccgcgcgtggtcgccatgctggcg
cgcgcgctcatgcaggggctgctgcaggcgggcatggccaactgcggcaagcatttcccg
ggccacggcttcgtccgggccgactcgcacaccgagatcccggtggaccggcgcagcctc
aaggccatcctgcaggatgacgcggcgccgtacccgtggctgtccaccgtgcttaccagc
gtcatgccggcgcacgtcatctatcccaaggtggacggccgccccgcgggcttctcggcc
aggtggctgcaggacatattgcgcggccggctgcgcttcgacggcgccatcttcagcgat
gacctgagcatggagggcgcgcggcgcatcgatggccaggtggtcggctacaccgacgcg
ggcgtggccgcgctcaatgccggctgcgacctggtgctgctgtgcaaccagagcctgggc
gacggccaggccgtggacgaactcatagccggcctggccgacgcccaggccgcgggccgc
tggcaggccagcagggccagcgaggcgcgccgccaggcgctgctgcccgagaccctgccg
cagccctgggacgacctcatggtgcagccggcctacatgcacgcgctggacctgctgcca
tga

DBGET integrated database retrieval system