KEGG   Alicycliphilus denitrificans K601: Alide2_1279Help
Entry
Alide2_1279       CDS       T01463                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:adk00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:adk00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339921..1341003
Genome map
AA seq 360 aa AA seqDB search
MTEHAPLIIDVAGTQLSADDRRRLAHPLVGGVILFARNWQDRAQLLALTAAIKAVRHDLL
ICVDHEGGRVQRFRTDGFTHIPPMRAFGELWMNDGKAGQGSGALRAMEAATAAGYVLGSE
LRACGVDFSFTPVLDLDWGESGVIGDRAFHRDPRVVAMLARALMQGLLQAGMANCGKHFP
GHGFVRADSHTEIPVDRRSLKAILQDDAAPYPWLSTVLTSVMPAHVIYPKVDGRPAGFSA
RWLQDILRGRLRFDGAIFSDDLSMEGARRIDGQVVGYTDAGVAALNAGCDLVLLCNQSLG
DGQAVDELIAGLADAQAAGRWQASRASEARRQALLPETLPQPWDDLMVQPAYMHALDLLP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatgcacccctcatcatcgacgtggccggcacgcagctgagcgccgacgac
cgccgccgcctggcccacccgctcgtgggcggcgtgatcctgttcgcgcgcaactggcag
gaccgcgcgcagctgctcgcgctcacggccgccatcaaggccgtgcgccacgacctgctg
atctgcgtggaccacgagggcgggcgcgtgcagcgctttcgcaccgacggcttcacccac
atcccgcccatgcgcgctttcggcgaactgtggatgaacgacggcaaggcggggcagggc
agcggcgcgctgcgcgccatggaggcggccacggcggcgggctacgtgctgggcagcgag
ctgcgcgcctgcggcgtggacttttccttcacgcccgtgctggacctggattggggcgag
agcggcgtgatcggcgaccgcgcgttccaccgcgacccgcgcgtggtcgccatgctggcg
cgcgcgctcatgcaggggctgctgcaggcgggcatggccaactgcggcaagcatttcccg
ggccacggcttcgtccgggccgactcgcacaccgagatcccggtggaccggcgcagcctc
aaggccatcctgcaggatgacgcggcgccgtacccgtggctgtccaccgtgcttaccagc
gtcatgccggcgcacgtcatctatcccaaggtggacggccgccccgcgggcttctcggcc
aggtggctgcaggacatattgcgcggccggctgcgcttcgacggcgccatcttcagcgat
gacctgagcatggagggcgcgcggcgcatcgatggccaggtggtcggctacaccgacgcg
ggcgtggccgcgctcaatgccggctgcgacctggtgctgctgtgcaaccagagcctgggc
gacggccaggccgtggacgaactcatagccggcctggccgacgcccaggccgcgggccgc
tggcaggccagcagggccagcgaggcgcgccgccaggcgctgctgcccgagaccctgccg
cagccctgggacgacctcatggtgcagccggcctacatgcacgcgctggacctgctgcca
tga

DBGET integrated database retrieval system