KEGG   Alicycliphilus denitrificans K601: Alide2_1280Help
Entry
Alide2_1280       CDS       T01463                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide2_1280
   01230 Biosynthesis of amino acids
    Alide2_1280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_1280
   00030 Pentose phosphate pathway
    Alide2_1280
   00051 Fructose and mannose metabolism
    Alide2_1280
   00052 Galactose metabolism
    Alide2_1280
  Energy metabolism
   00680 Methane metabolism
    Alide2_1280
Enzymes [BR:adk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alide2_1280
Protein phosphatases and associated proteins [BR:adk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Alide2_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341000..1342067
Genome map
AA seq 355 aa AA seqDB search
MNMRIGVLTGGGDCPGLNAVIRAVTKSLIQHGHGKGVEVLGILDGFEGLMGDTPRARPLV
WDRVSGILHMGGTILGTSNSANPLKDEATLEQVRRNVRALGLDVVVAIGGDGTMSLAHGL
QKIGLACVGVPKTIDNDIALCERSFGFDTAVATATDALRRVESTANSHHRVMIVETMGRH
AGWLALESGIAGAADVILLPEIDYDLQAIIDRCREREQRQRYTIICIGEGAKPRGGEITV
RERVAGSPDPVRLGGVGHVLRQQLQPHLKSEVRTTVLGYVQRGGDPTPFDRVLATRFGHH
AAQLVIAGQLDRMVTLQDGRIGSVEIARVANTQRKVPPNHDLITMARDIGVCLGD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgcatcggcgtgctcacgggcgggggcgattgccccggcctgaacgcggtg
atccgcgccgtcaccaagtcgctgatccagcatggccacggcaagggggtcgaggtgctg
ggcatcctggacggcttcgagggcctgatgggcgacacgccgcgcgcccggccgctggtg
tgggaccgggtctcgggcatcctgcacatgggcggcaccatcctgggcacgagcaacagc
gccaaccccctgaaggacgaggccacgctggagcaggtgcggcgcaacgtgcgcgccctg
ggcctggacgtggtcgtggccataggcggcgacggcaccatgagcctggcgcacggcctg
cagaaaatcggcctggcctgcgtgggcgtgcccaagaccatagacaacgacatcgcgctg
tgcgagcgcagcttcggcttcgacacggccgtggccacggccaccgacgcgctgcgccgg
gtggagagcacggccaacagccatcaccgcgtgatgatcgtcgagaccatgggccgccac
gcgggctggctggcgctggagagcggcatcgcaggcgcggccgacgtgatcctgctgccc
gagatcgactacgacctgcaggccatcatcgaccgctgccgcgagcgcgagcagcgccag
cgctacaccatcatctgcataggcgagggcgccaagccgcgcggcggcgagatcaccgtg
cgcgagcgcgtggccggcagccccgacccggtgcgcctaggtggcgtgggccacgtgctg
cgccagcagctgcagccgcacctcaagagcgaggtgcgcaccaccgtgctgggctacgtg
cagcgcggcggcgaccccacgccgttcgaccgcgtgctggccacgcgcttcggccatcat
gcggcgcaactggtgatcgccggccagctggaccgcatggtcacgctgcaggacgggcgc
atcggcagcgtggagatcgcccgggtggcgaacacccagcgcaaggtgccgccgaaccac
gacctgatcaccatggcacgcgacatcggcgtgtgcctgggtgattga

DBGET integrated database retrieval system