KEGG   Alicycliphilus denitrificans K601: Alide2_1280Help
Entry
Alide2_1280       CDS       T01463                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00030  Pentose phosphate pathway
adk00051  Fructose and mannose metabolism
adk00052  Galactose metabolism
adk00680  Methane metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_1280
   00030 Pentose phosphate pathway
    Alide2_1280
   00051 Fructose and mannose metabolism
    Alide2_1280
   00052 Galactose metabolism
    Alide2_1280
  Energy metabolism
   00680 Methane metabolism
    Alide2_1280
Enzymes [BR:adk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alide2_1280
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Alide2_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEB83684
UniProt: F4GD01
Position
1341000..1342067
Genome map
AA seq 355 aa AA seqDB search
MNMRIGVLTGGGDCPGLNAVIRAVTKSLIQHGHGKGVEVLGILDGFEGLMGDTPRARPLV
WDRVSGILHMGGTILGTSNSANPLKDEATLEQVRRNVRALGLDVVVAIGGDGTMSLAHGL
QKIGLACVGVPKTIDNDIALCERSFGFDTAVATATDALRRVESTANSHHRVMIVETMGRH
AGWLALESGIAGAADVILLPEIDYDLQAIIDRCREREQRQRYTIICIGEGAKPRGGEITV
RERVAGSPDPVRLGGVGHVLRQQLQPHLKSEVRTTVLGYVQRGGDPTPFDRVLATRFGHH
AAQLVIAGQLDRMVTLQDGRIGSVEIARVANTQRKVPPNHDLITMARDIGVCLGD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgcatcggcgtgctcacgggcgggggcgattgccccggcctgaacgcggtg
atccgcgccgtcaccaagtcgctgatccagcatggccacggcaagggggtcgaggtgctg
ggcatcctggacggcttcgagggcctgatgggcgacacgccgcgcgcccggccgctggtg
tgggaccgggtctcgggcatcctgcacatgggcggcaccatcctgggcacgagcaacagc
gccaaccccctgaaggacgaggccacgctggagcaggtgcggcgcaacgtgcgcgccctg
ggcctggacgtggtcgtggccataggcggcgacggcaccatgagcctggcgcacggcctg
cagaaaatcggcctggcctgcgtgggcgtgcccaagaccatagacaacgacatcgcgctg
tgcgagcgcagcttcggcttcgacacggccgtggccacggccaccgacgcgctgcgccgg
gtggagagcacggccaacagccatcaccgcgtgatgatcgtcgagaccatgggccgccac
gcgggctggctggcgctggagagcggcatcgcaggcgcggccgacgtgatcctgctgccc
gagatcgactacgacctgcaggccatcatcgaccgctgccgcgagcgcgagcagcgccag
cgctacaccatcatctgcataggcgagggcgccaagccgcgcggcggcgagatcaccgtg
cgcgagcgcgtggccggcagccccgacccggtgcgcctaggtggcgtgggccacgtgctg
cgccagcagctgcagccgcacctcaagagcgaggtgcgcaccaccgtgctgggctacgtg
cagcgcggcggcgaccccacgccgttcgaccgcgtgctggccacgcgcttcggccatcat
gcggcgcaactggtgatcgccggccagctggaccgcatggtcacgctgcaggacgggcgc
atcggcagcgtggagatcgcccgggtggcgaacacccagcgcaaggtgccgccgaaccac
gacctgatcaccatggcacgcgacatcggcgtgtgcctgggtgattga

DBGET integrated database retrieval system