KEGG   Alicycliphilus denitrificans K601: Alide2_1299Help
Entry
Alide2_1299       CDS       T01463                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adk01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:adk00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:adk00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1360072..1360881)
Genome map
AA seq 269 aa AA seqDB search
MSRIADTFAALQEKGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEKALSLGIGMPQVLEMVRSFRQRNQTTPVVLMGYANPVERYDQRHGKGAFAR
DAGAAGVDGVLVVDYPPEECEQFAADLRAHGIDLIFLLAPTSTPERMQQVARVASGYVYY
VSLKGVTGSGALDTAAVESMLPRIREHVKIPVGVGFGIRDAATAQAIGRVADAVVIGSRI
IQLIEDQPHEKVVGITVDFLRGIRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgctgacaccttcgccgccctgcaggaaaagggtcgcaaggcgctcatc
ccctacgtgacggcgggcttcccgttcgccgacatcacgcccgcgctcatgcacggcatg
gtggaggccggcgccgacgtgatcgagctcggcgtgcccttctccgaccccatggccgac
ggcccggtgatccagaaggcgggcgagaaggccctgtccctgggcatcggcatgccgcag
gtgctggagatggtgcgcagtttccgccagcgcaaccagaccacgcccgtggtgctcatg
ggctacgccaacccggtggagcgctacgaccagcgccacggcaagggcgcgttcgcccgc
gatgccggcgcggccggcgtggacggcgtgctcgtcgtggactacccgcccgaggaatgc
gagcagttcgccgccgacctgcgcgcacacggcatcgatctgatcttcctgctcgccccc
acctccacgcccgagcgcatgcagcaggtggcgcgcgtggccagcggctacgtgtactac
gtctcgctcaagggcgtgacgggctcgggcgcgctcgacaccgccgccgtcgagtccatg
ctgccgcgcatccgcgagcacgtgaagatccccgtcggcgtgggcttcggcatccgcgac
gcggccacggcccaggccatcggccgcgtggccgacgccgtggtcatcggcagccgcatc
atccagctcatcgaggaccagccgcacgagaaggtggtcggcatcaccgtggacttcctg
cgcggcatccgcaaggcgctcgacgcataa

DBGET integrated database retrieval system