KEGG   Alicycliphilus denitrificans K601: Alide2_1370Help
Entry
Alide2_1370       CDS       T01463                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:adk00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1437824..1439758)
Genome map
AA seq 644 aa AA seqDB search
MSKKEDLGTETVGMGRRRFINTAALAGLTVGVAACNDKPAASPAASGTPASAPAPAAHAG
SGANVHLKPGELDTYYGLWSGGHNGDVRVLGLPSGREIHRIPCFVPDALVGWGITNESKA
VMGTKPDGNLRYTVADTHHLHASYKDGNYDGRYAWVNDKINARIARIRLDYFVCDKITDL
PNVQGFHGIFPDKADPVDPAINYTTRVFCGGEFAIPLPNDGKDVNAPEKYRSLFTCVDAE
TMEVRWQVLIDGNCDLVATSYDGKLAATNQYNTENGIHYEDMMSAERDACLFFNVARIEE
AVKAGKFKTYGNKVPVVDGTHEANKDPKTALVAYVSVPKNPHGVNASPDGKYFICAGKLS
PTTTTIELAKVLDWFDGKMEKLDDAIVAEVEVGLGPLHTAFDGRGNAYTTLFLDSQIVKW
NVEKAIAFHKGDKNAKYVVDRIDVHYQPGHINASQSETKAADGKFLAVGCKFSKDRFLPV
GPLHPENEQLIDISGEKMVLLADHPVRGEPHDFIIFKRDLLKPKQVYELDEFPLAVKDAK
ESGVFRNGKKVTVKLTSQAPAFSMREFTVKKGDEVTLILTNLDKIEDLTHGFALPKYNIQ
FVINPLETKSVTFVADKPGVFWAYCSTFCHALHLEMRTRMIVEA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaagaagacctgggcaccgaaaccgtcggcatgggccggcgccgtttcatc
aacaccgccgcgctggcgggcctgacggtaggcgtcgctgcttgcaacgacaaacccgcc
gcgtccccggcggcatcgggcacccccgcctccgcgcccgcaccggccgcgcatgccggc
agcggcgcgaacgtgcacctcaagcccggtgagctcgacacctactacggcctgtggagc
ggcggccacaacggcgacgtgcgcgtgctgggcctgccttcgggccgcgagatccaccgc
attccctgcttcgtgcccgacgcgctcgtgggctggggcatcaccaacgaatccaaggcc
gtcatgggcaccaagcccgacggcaacctgcgctacacggtggccgacacccaccacctg
catgcctcgtacaaggacggcaattacgacggtcgctacgcctgggtcaacgacaagatc
aatgcccgcatcgcacgcatccgcctggactacttcgtctgcgacaagatcaccgacctg
cccaacgtgcagggcttccacggcatcttccctgacaaggccgacccggtcgatcccgcg
atcaactacacgacgcgcgtgttctgcggcggcgagttcgccattcccctgcccaacgac
ggcaaggacgtgaatgctcccgagaagtaccgctcgctgttcacctgcgtggacgccgag
accatggaagtgcgctggcaggtgctgatcgacggcaactgcgacctggtcgccacctcg
tacgatggcaagctcgcggccaccaaccagtacaacaccgagaacggcatccactacgag
gacatgatgtccgccgagcgcgacgcctgcctgttcttcaacgtggcgcgcatcgaggag
gccgtgaaggccggcaagttcaagacctatggcaacaaggtgcccgtagtggacggcacg
cacgaggccaacaaggacccgaagacggccctggtcgcctacgtcagcgttccgaagaac
ccgcacggcgtgaacgccagccccgacggcaagtacttcatctgcgccggcaagctctcg
cccaccaccacgaccatcgagctcgccaaggtgctggactggttcgacggcaagatggag
aagctcgacgacgccatcgtcgccgaggtcgaagtgggcctgggccccttgcacaccgcc
ttcgacggccgcggcaacgcctacaccacgctgttcctggacagccagatcgtcaagtgg
aacgtggagaaggccatcgccttccacaagggcgacaagaacgccaagtacgtggtggac
cgcatcgacgtgcactaccagcccggccacatcaacgcatcgcagtccgagaccaaggcc
gccgacggcaagttcctggccgtgggctgcaagttctccaaggaccgcttcctgcccgtg
ggcccgctgcaccccgagaacgagcaactgatcgacatctcgggcgagaagatggtgctg
ctggccgaccacccggtgcgcggcgaaccgcacgacttcatcatcttcaagcgcgacctc
ctcaagcccaagcaggtgtacgagctggacgagttcccgctggccgtcaaggacgccaag
gaatcaggcgtgttccgcaacggcaagaaggtcaccgtcaagctcacctcgcaggcgccg
gccttcagcatgcgcgagttcaccgtgaagaagggcgacgaggtcacgctgatcctgacc
aacctggacaagatcgaggacctgacgcacggcttcgccctgcccaagtacaacatccag
ttcgtcatcaacccgctggagaccaagtcggtcaccttcgtggccgacaagcctggcgtg
ttctgggcttactgctccacgttctgccatgcgctgcaccttgagatgcgcacgcgcatg
atcgtcgaggcctga

DBGET integrated database retrieval system