KEGG   Alicycliphilus denitrificans K601: Alide2_1400Help
Entry
Alide2_1400       CDS       T01463                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
adk  Alicycliphilus denitrificans K601
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1475990..1477570)
Genome map
AA seq 526 aa AA seqDB search
MKLRSVTLRTLCIFLPILQMDSAKSPSEVARETLKLLAARRLSPTPDNYQALYEEVSGVR
AAPNFPTAQLRHILHVMPGQTPGQKRLLGQLENAVAQQDWSMLKNVLVGYANLGLSPVAT
PPPASVSITQLPTTLAQNLARLVSNTLPALGEDDPRVHELAAQLCAFLREPERPIATAEL
MLSDFSYRLSFAAEDQAAIRQGLLGLLRLVFENIAALSIDEPWLHGQAEALLAASTPPLT
LRRLDDVHKRLKDVIFKQSEAKDRTVQAQTQMRELLATFIERLAQMDESSSTYNETMERC
AERIGRATQLQDIMPLLEEVMAATRAMALNSHVTRSELQDLRERTEATHAEITQLRRDLD
HASAQARHDPLTGALNRKGLDEAMEREIARAFRLDTPLCVALLDVDNFKAINDRLGHAAG
DEALMHLVRVTREVMRPQDQLARHGGEEFVLILPNTQLADGVKAMERLQRELTKRYFLKE
QERLLITFSAGVAQVEGKNGSADAIRRADEGMYLAKRSGKNRVVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcgctctgtcacacttcgcactctttgcatcttcctgcccatcctgcagatg
gactccgccaaatctccttccgaagtcgcgcgtgaaaccctcaagctcctggccgcgcgc
cgcctctcccccacccccgacaattaccaggccctgtacgaagaggtgtcgggcgtccgc
gccgcgccgaattttcccaccgcacagctgcgccatattctgcatgtgatgccggggcag
acccccgggcagaagcgcctgctgggccagctggagaacgccgtcgcgcagcaagactgg
tccatgctgaaaaacgtgctggtgggctacgccaacctgggcctgtcgccagtcgccacg
ccgccgcccgccagcgtcagcatcacccagctgcccaccacgctggcgcagaacctggca
cgcctggtgagcaacaccctgccggccctgggcgaagacgacccccgcgtgcacgagctg
gccgcgcagctgtgcgccttcctgcgcgagcccgagcgccccatcgccacggccgaactg
atgctgagcgacttcagctatcgcctgtccttcgccgcggaggaccaggccgccatacgg
cagggcctgctcgggctgctgcgcctggtattcgagaacattgccgcgctgagcatcgac
gagccatggctgcacggccaggccgaggcgctgctggccgcatccacgccgccgctcacg
ctgcgtcggctcgacgacgtgcacaagcgcctcaaggacgtgatcttcaagcagtccgag
gccaaggaccgcacggtccaggcacagacgcagatgcgcgagctgctggccaccttcatc
gagcgcctggcgcagatggacgaatcgagcagcacctacaacgaaaccatggagcgctgt
gccgaacgcatcggccgtgcgacgcagctgcaggacatcatgccgctgctcgaggaagtc
atggccgccacccgcgccatggcgctgaacagccacgtgacgcgctccgagctgcaggac
ctgcgcgagcgcaccgaggccacgcatgccgagatcacccagctgcgccgcgacttggac
cacgcgagcgcccaggcccgccacgacccgctgaccggagccctgaaccgcaaggggctg
gacgaggccatggagcgcgagatcgcgcgcgcgttccgcctggataccccgctgtgcgtg
gccctgctcgacgtggacaacttcaaggccatcaacgaccgcctgggccatgccgcaggc
gacgaggcgctgatgcacttggtccgggtcacgcgcgaggtcatgcggccccaggaccag
ttggcgcgccacggcggcgaggagttcgtgctcatcctgcccaacacccagctcgccgac
ggcgtgaaagccatggagcgcctgcagcgcgagctgaccaagcgctacttcctgaaggaa
caggagcgcctgctcatcaccttcagcgctggcgtggcgcaggtggagggcaagaacggc
agcgccgatgccatccgccgcgccgacgagggcatgtacctggccaagcgctcgggcaag
aaccgcgtggtggctgcgtag

DBGET integrated database retrieval system