KEGG   Alicycliphilus denitrificans K601: Alide2_1402Help
Entry
Alide2_1402       CDS       T01463                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Alide2_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478457..1479230
Genome map
AA seq 257 aa AA seqDB search
MQRRPGFPARIDWTKDAAPAASLAPARVRREAPPPTPQGVGLDSAAVRARMVQRLAAAGI
TAVPVLQAMGNVERHRFVDTALVNQAYEDTSLPIGLGQTISKPSVVARMTELLLGAQCAR
AGGLGRVLEIGTGCGYQAAVLARLAREVYTIERLRALHEKARENLRPLRLANVHLILGDG
MLGYAGGAPYAGIISAAGGGSLPPQWCEQLAMGGRLVAPMAGVDGRQMLLVVDKTPKGLE
QTVLEAVHFVPLKSGVV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgccccggattccccgcgcgcatcgattggacgaaggatgcggcgccggct
gcctccctcgcgccggcgcgtgtccggcgcgaggcgccgccgcccacaccccagggcgtg
ggcctggattcggccgcggtacgggcgcgcatggtgcagcggctggcggcggcgggcatc
accgcggtgccggtgctgcaggccatggggaacgtggagcggcaccgcttcgtcgatacc
gccctggtcaaccaggcctacgaggacaccagcctgcccatagggctgggccagaccatc
tccaagcccagcgtggtggcgcgcatgaccgagctgctgctgggcgcgcagtgcgcgcgc
gcgggcggcctggggcgggtgctggagatcggcaccggctgcggctaccaggcggccgtg
ctggcgcggctggcgcgcgaggtgtacaccatagagcgcctgcgcgcgttgcatgaaaag
gcgcgcgagaacctgcgccccttgcgcttggcaaacgtccatctgatcctgggcgacggc
atgctgggctatgccggcggcgcaccctatgcgggcatcatttccgcggcgggcggcggc
agcctcccgccgcagtggtgtgagcagcttgccatgggggggcgcctcgtggcccccatg
gcgggggtggacgggcgccagatgttgctcgtggttgacaaaacgccgaaaggcctggag
cagacggtgctcgaagccgtgcatttcgtccccctaaaatcgggggtcgtttga

DBGET integrated database retrieval system