KEGG   Alicycliphilus denitrificans K601: Alide2_1673Help
Entry
Alide2_1673       CDS       T01463                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00071  Fatty acid degradation
adk00280  Valine, leucine and isoleucine degradation
adk00281  Geraniol degradation
adk00310  Lysine degradation
adk00360  Phenylalanine metabolism
adk00362  Benzoate degradation
adk00380  Tryptophan metabolism
adk00410  beta-Alanine metabolism
adk00627  Aminobenzoate degradation
adk00640  Propanoate metabolism
adk00650  Butanoate metabolism
adk00903  Limonene and pinene degradation
adk00930  Caprolactam degradation
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01212  Fatty acid metabolism
Module
adk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Alide2_1673
   00650 Butanoate metabolism
    Alide2_1673
  Lipid metabolism
   00071 Fatty acid degradation
    Alide2_1673
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide2_1673
   00310 Lysine degradation
    Alide2_1673
   00360 Phenylalanine metabolism
    Alide2_1673
   00380 Tryptophan metabolism
    Alide2_1673
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Alide2_1673
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Alide2_1673
   00281 Geraniol degradation
    Alide2_1673
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide2_1673
   00627 Aminobenzoate degradation
    Alide2_1673
   00930 Caprolactam degradation
    Alide2_1673
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Alide2_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEB84064
UniProt: F4G403
Position
1773663..1774439
Genome map
AA seq 258 aa AA seqDB search
MTEVLVHRQDAIAVLTINRPRAKNSLNRAVFDGLHAQLAQLRHDESVRALILTGAEGVFC
AGADITAFDALRAEPLLGARAAAGGMLWPALAGFPKPVIAAVEGLALGGGMELALACDIV
IAGESARFGVPEVKLGAIPGGGGTQRLIRAAGKSKAMALLLTGDFMDARKACEAGIVADV
VADGQALPAALAMAARIAANSPLAVALAKDAALCSFETSLAQGLEHEKRNFGVAMHSADS
REGQEAFLGRRAPRFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtgctggtccaccgccaggacgccatcgccgtcctgaccatcaaccgcccg
cgcgcaaagaacagcctgaaccgcgcggtcttcgatgggctccacgcgcagctcgcgcaa
ctgcgccacgacgagtcggtgcgggcgctcatcctcaccggcgccgaaggcgtgttctgc
gccggcgccgacatcacggcattcgacgcactgcgcgccgaaccgctgctgggcgcgcgc
gcggcggcgggcggcatgctgtggcccgcgctggcgggctttccgaaacccgtgatcgcg
gccgtggaggggctggcgctgggcggcggcatggagcttgcgctggcctgcgacatcgtg
atcgccggcgagtcggcccgcttcggcgtgcccgaggtcaagctcggcgccatacccggt
ggcggcggcacccagcgcctgatccgggccgcgggcaagtccaaggcgatggcgctgctg
ctgaccggcgacttcatggacgcgcgcaaggcatgcgaggccggcatcgtcgccgacgtg
gtggcggacggccaggccttgccggcggcactggccatggctgcccggatcgccgccaat
tcgccgctggcggtggcgctggcgaaggacgcagccctgtgcagcttcgagacctcgctc
gcgcaggggctggagcatgagaagcgcaatttcggcgttgccatgcattcggccgacagc
cgcgaaggccaggaggcattcctgggccggcgcgcaccccggttcacgggccgctga

DBGET integrated database retrieval system