KEGG   Alicycliphilus denitrificans K601: Alide2_2043Help
Entry
Alide2_2043       CDS       T01463                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Alide2_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2135854..2136354
Genome map
AA seq 166 aa AA seqDB search
MIRPPQRRTVTALTLSAAALVGIVLHEGYTDRAVIPVKGDVPTIGFGTTTDVKLGDTTTP
PKALARALTDVQQFEGALKTCVTVPLAQHEYDALVSFSYNVGSRAFCQSTLVRKLNAEDY
AGACSELLRWRFFQGKDCALPANVRLCGGLATRRQSEYRQCVGEAP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatccggccaccgcaacgacgcaccgtgaccgcgctgacgctgtctgccgccgccctg
gtcggcatcgtgctgcacgagggctacaccgaccgcgcagtgatcccggtcaagggtgat
gtgccgaccatcggcttcggcaccaccacggacgtgaagctgggcgacaccaccacgccg
ccgaaggcgctggcccgcgcgctcaccgacgtgcagcagttcgagggcgcattgaaaacg
tgcgtgaccgtgccgctggcccagcacgagtacgacgcgctggtgagtttctcctacaac
gtcggcagccgcgcgttctgccaatccacgctggtgaggaaactcaacgccgaggactac
gccggagcctgttccgagctgctgcgctggcgcttcttccagggcaaggactgcgcgctg
cctgccaatgtacgcctgtgcggcgggctggccacgcgtcggcagtccgaataccgccag
tgcgtcggagaagcgccatga

DBGET integrated database retrieval system