KEGG   Alicycliphilus denitrificans K601: Alide2_2078Help
Entry
Alide2_2078       CDS       T01463                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00220  Arginine biosynthesis
adk00250  Alanine, aspartate and glutamate metabolism
adk00471  D-Glutamine and D-glutamate metabolism
adk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alide2_2078
   00220 Arginine biosynthesis
    Alide2_2078
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Alide2_2078
Enzymes [BR:adk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Alide2_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEB84451
UniProt: F4G8U2
Position
complement(2168352..2169278)
Genome map
AA seq 308 aa AA seqDB search
MGHAALETLQGFLVGLDARMKRAHKRGRVAHYIPQLASVDVHQFGISVCLASGERLSAGD
AATPFSIQSISKVFSLAIALGRHGDRLWKRVGKEPSNYTFNSVIELEQEGGKPRNPFVNA
GALVTTDAMLDAPDAGCGLDELMDFVRTAAGDDRISIDEQVAASEYRTAYRNFSLAYFLR
SCGNLHMECERLLQIYCRQCAITMNCEQLASAGRFLAGFDSAAHLLNPAQARSINALMLL
AGHYDGSGDFAYSVGFPGKSGVGGGILAVVPGHASIAVWSPGLNAFGNSLLGTRALQELS
EFTGWSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgccgctttggaaacgctccagggctttctggtagggctcgacgcgcgcatg
aagcgcgcacacaagcgcggccgggtggcgcactacattccgcaactggccagcgttgat
gtgcatcagttcgggatcagtgtgtgcctggccagcggagagcggctgagcgcgggcgac
gctgcgacgccgttttcgatccagagcatctcaaaggtcttctcactggcgatcgcattg
ggccgtcacggcgaccggctctggaagcgggtgggcaaggaaccatctaactacaccttc
aactcggtcatcgagcttgagcaggaaggcggcaaaccgcgcaatcctttcgtcaatgcg
ggcgcactggtcaccaccgacgccatgctcgatgcgcctgacgcaggctgcggactcgac
gaactgatggatttcgttcgcacggcggctggagatgaccggatctcgattgatgaacag
gttgccgcctcggaataccggacggcctaccgcaacttctctctggcgtactttctacgc
tcgtgcggcaatctgcacatggaatgcgaacgtctgctgcagatttactgtcgccaatgc
gcgatcacgatgaactgcgagcaattggccagcgccggccggttcctggccggcttcgac
tccgcagcccacctgctgaacccagctcaggcacgcagcatcaacgccttgatgttgctc
gcggggcactatgatggttcaggcgactttgcctattcggtcggcttccccggcaagagt
ggcgtcggaggcggcattctggcggtcgttccgggacatgcatcgatcgcggtctggtct
cctggcctgaatgcgtttggcaattcactgctcggcacgcgcgcgctgcaggagttatcg
gagttcaccggctggtcggtgttctga

DBGET integrated database retrieval system