KEGG   Alicycliphilus denitrificans K601: Alide2_2213Help
Entry
Alide2_2213       CDS       T01463                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00020  Citrate cycle (TCA cycle)
adk00190  Oxidative phosphorylation
adk00650  Butanoate metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
Module
adk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide2_2213
   00650 Butanoate metabolism
    Alide2_2213
  Energy metabolism
   00190 Oxidative phosphorylation
    Alide2_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEB84582
UniProt: F4G9T2
Position
complement(2310038..2310403)
Genome map
AA seq 121 aa AA seqDB search
MSATYGYKRTVVGAHYGWRDFLVQRITAVLIGVFTLLVLCKLLFTSGPIGYDTWAGIFAP
QWMKALTFSVIVAVIWHAWVGVCSVWYDYAKPAGLRLVLQALSIIWLVSCGGWAVQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaacctacggctacaagcgcaccgtcgtcggcgcccattacggttggcgcgac
ttcctggtgcaacgcatcaccgccgtgctgatcggcgtgttcaccctgctggtgctgtgc
aagctgctgttcacctcgggccccatcggctacgacacctgggccggcatcttcgcgccg
cagtggatgaaggcgctcacgttctccgtcatcgtcgcggtgatctggcatgcctgggtg
ggcgtgtgcagcgtctggtacgactacgccaagccggccggtctgcgcctcgtgctgcaa
gccctgtcgatcatctggctggtcagctgcggcggctgggccgtgcaggtgctgtggcgc
ctgtga

DBGET integrated database retrieval system