KEGG   Alicycliphilus denitrificans K601: Alide2_2416Help
Entry
Alide2_2416       CDS       T01463                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00020  Citrate cycle (TCA cycle)
adk00620  Pyruvate metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
Module
adk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_2416
   00020 Citrate cycle (TCA cycle)
    Alide2_2416
   00620 Pyruvate metabolism
    Alide2_2416
Enzymes [BR:adk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Alide2_2416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA DUF2118 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AEB84780
UniProt: F4GCC1
Position
2518331..2519980
Genome map
AA seq 549 aa AA seqDB search
MALIQIQVPDIGDFDEVGVIELLVKPGDQVAAEQSLITVESDKASMEIPSSHAGVVKALT
VKLGDKVKQGSVIAELETADAAASEPKPAPAPASQALAAAESIAPAAAPAAPAAGGRIEV
RVPDIGDFKDVAVIELLVKPGDNIRVEQSLFTVESDKASMEIPSPAAGVLKELKVQLGDK
VNIGDLVAVLEGAAPAAPAAPAPAPAPAAAPAAPVAAAAAAPASAQSAPAHDPTATPSGR
LPHASPSVRKFARELGVPLAELKGTGPKGRITAEDVQSFTRAVMSGAVQTQAQAAKAPAG
GGSGVGMDLLPWPKVDFSKFGVIERKDLSRIKKISGANLHRNWVMIPHVTNNDEADITEL
EAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNTSLDGDTLVYKSYYHIGFAAD
TPNGLVVPVLKDADKKGILQISQEMSELAKKARDGKLGAADMQGGCMSISSLGGIGGTHF
TPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAAAARFNAYLGQV
LADYRRILL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattcagatccaggtacccgacatcggggactttgacgaggtgggcgtgatc
gagctgctggtcaagcccggcgatcaggtcgcggccgagcagtcgctgatcaccgtcgag
tccgacaaggcttcgatggagatcccgtccagccacgcgggcgtcgtgaaggcgctcaca
gtgaagctgggcgacaaggtcaagcagggcagcgtgatcgccgagctggaaacggccgac
gcggcggcttctgagccaaaaccggctccggcgcccgccagccaagcgctggcagctgcg
gaatccatagcgcccgcggcggcgcccgcagcgcccgcggcaggcggccgcatcgaggtg
cgcgtgcccgacatcggcgacttcaaggatgtggccgtgatcgagctgctggtcaagccc
ggcgacaacatccgcgtcgagcagtcgctgttcaccgtcgaatccgacaaggcctcgatg
gagatcccgtcgcccgcggccggcgtgctcaaggagctcaaggtccagctgggcgacaag
gtcaacatcggggacttggtggcggtgctcgaaggcgccgccccggcagcgcccgccgcg
ccggcgcctgcccccgcccccgcggcggcaccggccgcgcccgtggctgccgcggctgca
gcaccggcgtccgcgcagtccgcgcccgcgcacgaccccacggcgacgccatcgggccgg
ctgccgcacgccagcccctcggtgcgcaagttcgcccgcgaactgggcgtgccgctggcc
gagctcaagggcacgggccccaagggccgcatcacggcagaggacgtgcagtccttcacc
cgcgccgtcatgagcggcgccgtgcagacccaggcccaggccgccaaggccccggccggc
ggcggcagcggggtgggcatggacctgctgccctggcccaaggtggacttcagcaagttc
ggcgtgatcgagcgcaaggatctttcgcgcatcaagaagatcagcggcgccaacctgcac
cgcaactgggtgatgatcccgcacgtcaccaacaacgacgaggccgacatcaccgagctc
gaagccttccgcgtctccaccaacaaggagaacgagaagagcggcgtcaaggtcaccatg
ctggcgttcgtcatcaaggccgtcgtcgccgcgctcaagaaattccccgagttcaacacc
agcctggacggcgacaccctggtctacaagagctactaccacatcggcttcgcggccgac
acgcccaacggcctggtggttcccgtgctcaaggacgccgacaagaagggcatcctgcaa
atcagccaggagatgagcgaactggccaagaaggcgcgcgacggcaagctgggcgcggcc
gacatgcagggcggatgcatgtccatctcgtcgctcggcggcatcggcggcacgcacttc
acgcccatcatcaacgcgcccgaggtggcgatcctgggcctgtccaagggccagatgaag
cccgtgtgggacggcaagcagttcgtgccgcgcctcacgctgccgctgtcgctgtcgtac
gaccaccgcgtgatcgacggcgctgcggccgcgcgcttcaacgcctacctcggccaagtg
ctggcggactaccgccgcatcctgctgtga

DBGET integrated database retrieval system