KEGG   Alicycliphilus denitrificans K601: Alide2_2416Help
Entry
Alide2_2416       CDS       T01463                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:adk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:adk00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:adk00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adk00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2518331..2519980
Genome map
AA seq 549 aa AA seqDB search
MALIQIQVPDIGDFDEVGVIELLVKPGDQVAAEQSLITVESDKASMEIPSSHAGVVKALT
VKLGDKVKQGSVIAELETADAAASEPKPAPAPASQALAAAESIAPAAAPAAPAAGGRIEV
RVPDIGDFKDVAVIELLVKPGDNIRVEQSLFTVESDKASMEIPSPAAGVLKELKVQLGDK
VNIGDLVAVLEGAAPAAPAAPAPAPAPAAAPAAPVAAAAAAPASAQSAPAHDPTATPSGR
LPHASPSVRKFARELGVPLAELKGTGPKGRITAEDVQSFTRAVMSGAVQTQAQAAKAPAG
GGSGVGMDLLPWPKVDFSKFGVIERKDLSRIKKISGANLHRNWVMIPHVTNNDEADITEL
EAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNTSLDGDTLVYKSYYHIGFAAD
TPNGLVVPVLKDADKKGILQISQEMSELAKKARDGKLGAADMQGGCMSISSLGGIGGTHF
TPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAAAARFNAYLGQV
LADYRRILL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattcagatccaggtacccgacatcggggactttgacgaggtgggcgtgatc
gagctgctggtcaagcccggcgatcaggtcgcggccgagcagtcgctgatcaccgtcgag
tccgacaaggcttcgatggagatcccgtccagccacgcgggcgtcgtgaaggcgctcaca
gtgaagctgggcgacaaggtcaagcagggcagcgtgatcgccgagctggaaacggccgac
gcggcggcttctgagccaaaaccggctccggcgcccgccagccaagcgctggcagctgcg
gaatccatagcgcccgcggcggcgcccgcagcgcccgcggcaggcggccgcatcgaggtg
cgcgtgcccgacatcggcgacttcaaggatgtggccgtgatcgagctgctggtcaagccc
ggcgacaacatccgcgtcgagcagtcgctgttcaccgtcgaatccgacaaggcctcgatg
gagatcccgtcgcccgcggccggcgtgctcaaggagctcaaggtccagctgggcgacaag
gtcaacatcggggacttggtggcggtgctcgaaggcgccgccccggcagcgcccgccgcg
ccggcgcctgcccccgcccccgcggcggcaccggccgcgcccgtggctgccgcggctgca
gcaccggcgtccgcgcagtccgcgcccgcgcacgaccccacggcgacgccatcgggccgg
ctgccgcacgccagcccctcggtgcgcaagttcgcccgcgaactgggcgtgccgctggcc
gagctcaagggcacgggccccaagggccgcatcacggcagaggacgtgcagtccttcacc
cgcgccgtcatgagcggcgccgtgcagacccaggcccaggccgccaaggccccggccggc
ggcggcagcggggtgggcatggacctgctgccctggcccaaggtggacttcagcaagttc
ggcgtgatcgagcgcaaggatctttcgcgcatcaagaagatcagcggcgccaacctgcac
cgcaactgggtgatgatcccgcacgtcaccaacaacgacgaggccgacatcaccgagctc
gaagccttccgcgtctccaccaacaaggagaacgagaagagcggcgtcaaggtcaccatg
ctggcgttcgtcatcaaggccgtcgtcgccgcgctcaagaaattccccgagttcaacacc
agcctggacggcgacaccctggtctacaagagctactaccacatcggcttcgcggccgac
acgcccaacggcctggtggttcccgtgctcaaggacgccgacaagaagggcatcctgcaa
atcagccaggagatgagcgaactggccaagaaggcgcgcgacggcaagctgggcgcggcc
gacatgcagggcggatgcatgtccatctcgtcgctcggcggcatcggcggcacgcacttc
acgcccatcatcaacgcgcccgaggtggcgatcctgggcctgtccaagggccagatgaag
cccgtgtgggacggcaagcagttcgtgccgcgcctcacgctgccgctgtcgctgtcgtac
gaccaccgcgtgatcgacggcgctgcggccgcgcgcttcaacgcctacctcggccaagtg
ctggcggactaccgccgcatcctgctgtga

DBGET integrated database retrieval system