KEGG   Alicycliphilus denitrificans K601: Alide2_2416Help
Entry
Alide2_2416       CDS       T01463                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide2_2416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_2416
   00020 Citrate cycle (TCA cycle)
    Alide2_2416
   00620 Pyruvate metabolism
    Alide2_2416
Enzymes [BR:adk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Alide2_2416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2518331..2519980
Genome map
AA seq 549 aa AA seqDB search
MALIQIQVPDIGDFDEVGVIELLVKPGDQVAAEQSLITVESDKASMEIPSSHAGVVKALT
VKLGDKVKQGSVIAELETADAAASEPKPAPAPASQALAAAESIAPAAAPAAPAAGGRIEV
RVPDIGDFKDVAVIELLVKPGDNIRVEQSLFTVESDKASMEIPSPAAGVLKELKVQLGDK
VNIGDLVAVLEGAAPAAPAAPAPAPAPAAAPAAPVAAAAAAPASAQSAPAHDPTATPSGR
LPHASPSVRKFARELGVPLAELKGTGPKGRITAEDVQSFTRAVMSGAVQTQAQAAKAPAG
GGSGVGMDLLPWPKVDFSKFGVIERKDLSRIKKISGANLHRNWVMIPHVTNNDEADITEL
EAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNTSLDGDTLVYKSYYHIGFAAD
TPNGLVVPVLKDADKKGILQISQEMSELAKKARDGKLGAADMQGGCMSISSLGGIGGTHF
TPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAAAARFNAYLGQV
LADYRRILL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattcagatccaggtacccgacatcggggactttgacgaggtgggcgtgatc
gagctgctggtcaagcccggcgatcaggtcgcggccgagcagtcgctgatcaccgtcgag
tccgacaaggcttcgatggagatcccgtccagccacgcgggcgtcgtgaaggcgctcaca
gtgaagctgggcgacaaggtcaagcagggcagcgtgatcgccgagctggaaacggccgac
gcggcggcttctgagccaaaaccggctccggcgcccgccagccaagcgctggcagctgcg
gaatccatagcgcccgcggcggcgcccgcagcgcccgcggcaggcggccgcatcgaggtg
cgcgtgcccgacatcggcgacttcaaggatgtggccgtgatcgagctgctggtcaagccc
ggcgacaacatccgcgtcgagcagtcgctgttcaccgtcgaatccgacaaggcctcgatg
gagatcccgtcgcccgcggccggcgtgctcaaggagctcaaggtccagctgggcgacaag
gtcaacatcggggacttggtggcggtgctcgaaggcgccgccccggcagcgcccgccgcg
ccggcgcctgcccccgcccccgcggcggcaccggccgcgcccgtggctgccgcggctgca
gcaccggcgtccgcgcagtccgcgcccgcgcacgaccccacggcgacgccatcgggccgg
ctgccgcacgccagcccctcggtgcgcaagttcgcccgcgaactgggcgtgccgctggcc
gagctcaagggcacgggccccaagggccgcatcacggcagaggacgtgcagtccttcacc
cgcgccgtcatgagcggcgccgtgcagacccaggcccaggccgccaaggccccggccggc
ggcggcagcggggtgggcatggacctgctgccctggcccaaggtggacttcagcaagttc
ggcgtgatcgagcgcaaggatctttcgcgcatcaagaagatcagcggcgccaacctgcac
cgcaactgggtgatgatcccgcacgtcaccaacaacgacgaggccgacatcaccgagctc
gaagccttccgcgtctccaccaacaaggagaacgagaagagcggcgtcaaggtcaccatg
ctggcgttcgtcatcaaggccgtcgtcgccgcgctcaagaaattccccgagttcaacacc
agcctggacggcgacaccctggtctacaagagctactaccacatcggcttcgcggccgac
acgcccaacggcctggtggttcccgtgctcaaggacgccgacaagaagggcatcctgcaa
atcagccaggagatgagcgaactggccaagaaggcgcgcgacggcaagctgggcgcggcc
gacatgcagggcggatgcatgtccatctcgtcgctcggcggcatcggcggcacgcacttc
acgcccatcatcaacgcgcccgaggtggcgatcctgggcctgtccaagggccagatgaag
cccgtgtgggacggcaagcagttcgtgccgcgcctcacgctgccgctgtcgctgtcgtac
gaccaccgcgtgatcgacggcgctgcggccgcgcgcttcaacgcctacctcggccaagtg
ctggcggactaccgccgcatcctgctgtga

DBGET integrated database retrieval system