KEGG   Alicycliphilus denitrificans K601: Alide2_2636Help
Entry
Alide2_2636       CDS       T01463                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Alide2_2636
DNA repair and recombination proteins [BR:adk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Alide2_2636
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Alide2_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Cas_APE2256 TIR_2 Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AEB84993
UniProt: F4GEV7
Position
complement(2758259..2758849)
Genome map
AA seq 196 aa AA seqDB search
MSDTGSLDALIQALRRLPGVGVKSAQRMAFHLLQHDRGGAQQLSQALARACEQVRHCERC
HTFTEGAVCDTCLDPARDATRLCVVETPADQSALERTAAFKGLYFVLMGRLSPLDGVGPR
DIGVHKLLERAGDGVVQEVILATSFTAEGEATAHAIAEALKRRGIHVTRLARGVPVGSEL
EYVDLGTIAHALADRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccggctccctcgacgcgctgatccaggccctgcggcgcctgccgggcgtg
ggcgtgaagtcggcccagcgcatggccttccacctgctgcagcacgaccgcggcggggcg
cagcagctgtcgcaggcgctggcccgggcgtgcgagcaggtgcgccactgcgagcgctgc
cacaccttcaccgagggcgcggtgtgcgacacctgcctggacccggcgcgcgatgccacg
cgcctgtgcgtggtggagacgccggccgatcagtccgccctggagcgcacggccgccttc
aagggcctgtacttcgtgctcatgggccggctgtcgccgctggacggcgtggggccgcgc
gacatcggcgtgcacaagctgctggagcgcgccggcgacggcgtggtgcaggaggtgatc
ctggccaccagcttcaccgccgagggcgaggccacggcccacgccatcgccgaggcgctc
aagcgccgcggcatccacgtcacgcggctggcgcgcggcgtgcccgtgggcagcgagctg
gagtacgtggacttgggcaccatcgcccacgcgcttgcggaccggcgttga

DBGET integrated database retrieval system