KEGG   Alicycliphilus denitrificans K601: Alide2_2718Help
Entry
Alide2_2718       CDS       T01463                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
adk01230  Biosynthesis of amino acids
Module
adk_M00002  Glycolysis, core module involving three-carbon compounds
adk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_2718
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Alide2_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_N Gp_dh_C Gp_dh_N NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEB85070
UniProt: F4GFQ5
Position
complement(2847023..2848066)
Genome map
AA seq 347 aa AA seqDB search
MNKVRVAVNGYGVIGKRVADAVALQEDMALAGVADVVHDYRLQVAAQRGFAIHAATFEAE
GAMRAAGLALAGNLAELLAKADVVVDCTPKKVAAVNKEVYAAAGVKSIFHGGESHALTGH
SFVAQANYASAIGRESTRVVSCNTTSIVRTLGALRTAGLLKRARGTLIRRASDPWEAHAE
GIINTLVPEKAIPSHQGPDARTVIPDLDVVTIAVKASHNSSHLHTWWVELTRPATRDEVL
AAFRAAPRIAFVRSSDGLVALNSTVELMSDLGRPRGDMWEVALWEDVLAVDGDQAYYTYQ
VFNQAIVIPETIDAIRALSGIESDPSASIARTDAALGLRHDFIHDRD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtcagagtggcggtgaacgggtacggtgtgatcggcaagcgggtggcagac
gcggtcgcgctccaggaggacatggcacttgccggcgtcgcagacgtggtgcacgactat
cgactacaggtcgccgcgcagcgcggcttcgccatccacgcggcaacctttgaagctgaa
ggagcgatgcgcgccgcaggtcttgctttggcgggcaatctggcagaactgctcgcgaag
gccgatgtcgtggtcgactgcacgcccaagaaagtcgctgcggtcaacaaagaggtgtac
gccgcggccggcgtgaagtcgatcttccacggtggtgagtctcatgcgctgacggggcac
tcattcgtcgcgcaagcgaactatgcgtcggccatcggccgcgagtccactcgcgtggtc
tcctgcaacaccacgtccatcgtgcgaacgctgggggcgctgcggacggccggcctgctc
aagcgtgcacgcggcacgctcatccgccgcgcatccgacccctgggaagcgcatgctgag
ggcatcattaacaccctcgtgccggagaaggcgatccccagccaccagggaccggacgcg
aggaccgtgatcccggacctggatgtggtaacgatcgcggtcaaggcgtcccacaacagc
agtcacctgcacacctggtgggtcgaactgacgaggccggcaacgcgcgacgaggtgctg
gcggccttccgtgcggcaccacggatcgcgttcgtgcgttcctcggatggcctcgtggca
ctcaacagtacggtggagctgatgtccgatcttggccgcccgcgcggcgacatgtgggag
gtcgccctgtgggaggacgtcctcgcggtagatggcgaccaagcgtactacacctaccag
gtcttcaaccaggcgatcgtgattcccgaaaccatcgatgcgatccgcgcgctgagcggc
atcgagtccgatccgtcagcgtcaatcgctcggacggatgccgcactcggcttgcggcac
gacttcatccacgaccgcgactag

DBGET integrated database retrieval system